KEGG   Burkholderia plantarii PG1: BGL_1c29450Help
Entry
BGL_1c29450       CDS       T03632                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bgp  Burkholderia plantarii PG1
Pathway
bgp00620  Pyruvate metabolism
bgp00680  Methane metabolism
bgp00710  Carbon fixation in photosynthetic organisms
bgp01100  Metabolic pathways
bgp01120  Microbial metabolism in diverse environments
bgp01200  Carbon metabolism
Module
bgp_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bgp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BGL_1c29450
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BGL_1c29450
   00680 Methane metabolism
    BGL_1c29450
Enzymes [BR:bgp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BGL_1c29450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AJK47422
UniProt: A0A0B6RQ27
LinkDB All DBs
Position
1:3385787..3388963
Genome map
AA seq 1058 aa AA seqDB search
MARGGLPPASRQYRSLPFTRAFPRKPIVKSSGSARAARRNAASSNVTAPATTDAPARQRG
TTTAAQPAAKTATTKKPAKPAANGAATTTANGTATPAGKPAKTPARSGGAAPADRLKPKA
NGRTRDDKDQPLFEDIRYLGRLLGDVVREQEGDAVFEVVETIRQHAVKFRREDDREAAQA
LDKMLRKLTPEQTVSVVRAFSYFSHLANIAEDRHHNRRRRIHALAGSTPQAGTVAYALQT
LKAAGDASAEVIRRFFDEALIVPVLTAHPTEVQRKSILDAQHDIARLLAERDQELTTRER
SHNDALLRARVASLWQTRMLRDARLTVGDEIDNALSYYRATFLDELPALYADIEEALAEH
GLDTRVPAFFQMGSWIGGDRDGNPNVTAATLEEAIHRQGTVILEHYLEQVHKLGAELSVS
DLLVGASDEVKALAAASPDQSPHRVDEPYRRALIGIYTRIAASARVRLGEGVVAVRSAGR
GAPPVRATPYPDAEAFARDLRVLHESLVAHHGALLATPRLAPLVRAAETFGFHLASIDLR
QSSDIHEAVIAELFARAGVEADYAALPEADKLRVLLAALADPRPLRIPYVDYSELANSEL
GVLEKAREVRARFGPRAVRNYIISHTETVSDLVEVLLLQKETGLLDGTFGAGPADAQHSL
MVIPLFETIADLRNAPEIMGEYFALPGAAALVARQGGEQEVMLGYSDSNKDGGFLTSNWE
LYRAELALVELFRSHGTKLRLFHGRGGTVGRGGGPTYEAILSQPPGTVNGQIRLTEQGEV
IASKFSNPEIGRRNLETVVAATLEASLLPRNNAPAQLPAFEAAVQTLSDAAIATYRALVY
ETPGFTDYFFSSTPISEIAELNIGSRPASRKLQDPKHRRIEDLRAIPWGFSWGQCRLLLT
GWYGFGSAFAAYLDGAANDAERAKRLALLQKMNRTWPFFSHLLSNMDMVLSKVDLAVASR
YAELVADKKLRKQVFGRIVAEWERTTAALAAITGHEARLATNPLLARSIKNRFPYLDPLN
HLQVELIKRHRAGDTNARVRRGIHLTINGIAAGLRNTG
NT seq 3177 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcgcggcggtcttccgccggcaagtcgacagtaccgcagtctcccgttcactcgt
gctttcccaaggaaacccatcgtgaagtcctccggatcggcgcgcgctgcgcgccgcaat
gctgcctcgtccaacgtcaccgcgccggccacgaccgacgcccccgcgcgccagcgcggc
acgaccacggccgcccaacccgccgccaagacggcaacgacgaagaaaccggcaaaaccg
gccgccaacggcgccgcgacgaccaccgccaacggcacggccacgccggccggcaagccc
gcgaagacgccggcgcgaagcggcggcgcggccccggccgaccggctcaagccgaaagcg
aacggccgcacgcgcgacgacaaggaccagccgctgttcgaggacatccgctatctggga
cgcctgctcggcgacgtggtgcgcgagcaggaaggcgacgccgtgttcgaggtggtcgag
acgatccgccagcacgccgtgaaattccgccgcgaggacgatcgcgaggccgcgcaggcg
ctcgacaagatgctgcgcaagcttacgcccgagcagaccgtgagcgtggtgcgcgcgttc
agctacttctcgcatctggccaacatcgccgaggaccgccatcacaaccgccgccgccgg
atccacgcgctggccggctcgacgccgcaggccggcaccgtggcctacgcgctgcagacg
ctcaaggcggccggcgacgcgtcggccgaggtgatccgccgcttcttcgacgaagcgctg
atcgtgccggtgctgaccgcgcaccccaccgaagtgcagcgcaagagcatcctcgatgcc
cagcacgacatcgcgcggctgctcgccgagcgcgaccaggagctgaccacgcgcgaacgc
tcacacaatgacgcgctgctgcgcgcgcgggtggcctcgctgtggcagacccgcatgctg
cgcgatgcgcgcctcacggtgggcgacgagatcgacaacgcgctgtcctactatcgcgcg
acctttctcgacgagctgccggcgctctacgccgacatcgaggaagcgctcgccgaacac
ggcctggacacgcgcgtgccggccttcttccagatgggcagctggatcggcggcgaccgc
gacggcaatccgaacgtcacggccgccacgctcgaggaagcgatccaccgccagggcacc
gtgatcctcgaacactatctggagcaggtccacaagctcggcgccgagctgtcggtgtcg
gacctgctggtgggcgcgagcgacgaggtcaaggcgctcgcggcggcctcgccggaccag
tcgccgcatcgcgtcgacgagccgtaccgccgcgcgctgatcggcatctacacgcgcatc
gccgcgagcgcgcgcgtgcggctcggcgagggcgtggtggcggtgcgcagcgccgggcgc
ggcgcgccgccggtgcgcgcgacgccgtatccggatgccgaggcgttcgcgcgcgacctg
cgcgtgctgcacgagtcgctcgtcgcccatcacggcgcgctgctcgcgacgccgcgcctc
gcgccgctggtgcgcgcggccgagacgttcggcttccatctcgccagcatcgacctgcgc
cagagttcggacatccacgaggccgtgatcgccgagctgttcgcgcgcgccggcgtcgag
gccgactacgcggcgctgcccgaagccgacaagctgcgcgtgctgctcgccgcgctggcc
gatccgcgcccgctgcggattccctacgtcgactactccgaactcgcgaacagcgaactc
ggcgtgctcgagaaggcccgcgaggtgcgcgcgcgcttcggtccgcgcgcggtgcgcaac
tacatcatctcgcataccgagacggtctccgatctggtcgaggtgctgctgctgcagaag
gaaaccggcctgctcgacggcacgttcggtgccggcccggccgacgcgcagcattcgctg
atggtgatcccgctgttcgagacgatcgccgacctgcgcaacgcgcccgagatcatgggc
gagtacttcgcgctgccgggcgccgcggcgctcgtcgcgcgccagggcggcgagcaggag
gtgatgctcggctattcggacagcaacaaggacggcggcttcctgacctcgaactgggag
ctgtaccgcgccgagctcgcgctggtcgagctgttccgctcgcacggcaccaagctgcgc
ctgttccacggccgcggcggcacggtcggccgcggcggcggtccgacctacgaggcgatc
ctctcgcagccgcccggcaccgtgaacggccagatccgcctgaccgagcagggcgaggtg
atcgcgagcaagttctcgaatcccgagatcggccgccgcaacctcgaaacggtggtcgcc
gcgacgctcgaggcctcgctgctgccgcgcaacaacgcgcccgcgcagttgcccgcgttc
gaggccgccgtgcagacgctgtcggacgcggcgatcgccacctatcgcgcgctcgtctac
gagacgcccggcttcaccgactacttcttctcgtcgacgccgatcagcgagatcgccgag
ctgaacatcggcagccggcccgcctcgcgcaagctgcaggatccgaagcaccgccggatc
gaggatctgcgcgcgattccgtggggcttctcgtggggccagtgccggctgctgctgacg
ggctggtacggcttcggcagcgcgttcgcggcctacctcgacggtgccgccaacgacgcc
gagcgcgccaaacgcctcgcgctgctgcagaagatgaaccgcacctggccgttcttctcg
cacctgctctcgaacatggacatggtgctctcgaaggtcgacctggcggtggcctcgcgc
tacgcggaactcgtcgccgacaagaagctgcgcaagcaggtgttcggccgcatcgtcgcc
gaatgggaacgcaccacggccgcgctcgccgcgatcaccggccacgaggcgcggctcgcc
accaacccgctgctcgcgcgttcgatcaagaaccgcttcccgtacctcgatccgctgaac
cacctgcaggtcgagctgatcaagcgccaccgcgccggcgacaccaacgcgcgcgtgcgg
cgcgggatccatctgaccatcaacgggatcgccgccggcctgcgcaacaccggctga

DBGET integrated database retrieval system