KEGG   Burkholderia plantarii PG1: BGL_1c29700Help
Entry
BGL_1c29700       CDS       T03632                                 

Gene name
cobT
Definition
(GenBank) nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase CobT
  KO
K00768  nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase [EC:2.4.2.21]
Organism
bgp  Burkholderia plantarii PG1
Pathway
bgp00860  Porphyrin and chlorophyll metabolism
bgp01100  Metabolic pathways
Module
bgp_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:bgp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BGL_1c29700 (cobT)
Enzymes [BR:bgp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.21  nicotinate-nucleotide---dimethylbenzimidazole phosphoribosyltransferase
     BGL_1c29700 (cobT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DBI_PRT
Motif
Other DBs
NCBI-ProteinID: AJK47447
UniProt: A0A0B6RQ48
LinkDB All DBs
Position
1:complement(3419082..3420194)
Genome map
AA seq 370 aa AA seqDB search
MLTEAGAIHARAAIRNESGMNDIYPIPNVDALDDTLTATLQHLIDTKTKPPGSLGKLEAL
ALQLGRIQRSTAPRVERPVTIVFAADHGIAAEGVSPYPQAVTAQMVANFLAGGAAINAFS
KVGGCELEIVDAGVATPLPASPALVSVPVAAGTRNFARERAMSDAQLHTALAAGAARVAH
HAALGTNVIGCGEMGIANTSAAACLMSRFTGLPLAECVGRGTGLDDRGLAHKRAVLEAAL
ARHADVQTPLEVLAAFGGFEIAMMTGAFLAAAQARMTIVVDGFIASSALLAAVALAPAVR
DYCVFSHVSDETGHRRMLDHLGAAPLLALELRLGEGTGAALALPLLRAAAAFVNEMASFD
AAGVANRDDA
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgcttaccgaggccggcgcgatccacgcgcgggccgctatccgaaacgaatccggcatg
aacgatatctacccgatcccgaacgtcgacgcgctcgacgacacgctgacggcgacgctg
caacacctgatcgacaccaagaccaagccgcccggcagcctcggcaagctcgaagcgctc
gcgctgcaactgggccgcatccagcgcagcaccgcgccgcgcgtcgagcggcccgtgacg
atcgtgttcgcggccgaccacggcatcgcggccgagggcgtgagtccttatccgcaggcc
gtgacggcgcagatggtggcgaacttcctggccggcggcgcggcgatcaacgcgttctcg
aaggtcggcggctgcgagctggagatcgtcgacgcgggcgtggccacgccgctgccggcg
tcgcccgcgctggtgtcggtcccggtcgcggccggcacgcgcaacttcgcgcgcgaacgc
gcgatgagtgacgcgcaactgcatacggcgctcgcggccggcgcggcgcgcgtggcccac
cacgccgcgctcggcaccaacgtgatcggctgcggcgagatgggcatcgccaacacatcg
gcggcggcctgcctgatgagccgcttcacggggctgccgctcgccgaatgcgtgggacgc
ggcaccggtctcgacgatcgcgggctggcgcacaagcgagcggtgctggaggccgcgctc
gcacggcacgccgacgtgcagacgccgctcgaggtgctggccgcgttcggcggcttcgag
atcgcgatgatgacgggcgcgttcctcgcggccgcgcaggcgcgcatgacgatcgtggtg
gacggcttcatcgccagctcggcgctgctggccgccgtggcgctggcgccggcggtgcgc
gactactgcgtcttctcgcacgtctcggacgagactggccaccgccgcatgctcgaccat
ctcggcgccgcgccgctgctcgcgctcgagctgcggctcggcgagggcacgggcgccgcg
ctcgcgctgccgctgctgcgcgcggcggccgcgttcgtcaacgagatggccagcttcgat
gcggccggcgtcgcgaaccgcgacgacgcgtaa

DBGET integrated database retrieval system