KEGG   Burkholderia plantarii PG1: BGL_1c30490Help
Entry
BGL_1c30490       CDS       T03632                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase SodB
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bgp  Burkholderia plantarii PG1
Brite
Enzymes [BR:bgp01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BGL_1c30490 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AJK47525
UniProt: A0A0B6S2G4
LinkDB All DBs
Position
1:complement(3508310..3508969)
Genome map
AA seq 219 aa AA seqDB search
MRGYSVSPTIGRSAGPSPYTYTSKESVMAHTLPPLPYSEDALAPHISQETIQFHYGKHHQ
TYVTNLNNLIPGTEFENLSLEETVKKSSGGIFNNAAQIWNHTFFWNSLSPNGGGAPTGAL
GDAINAKWGSFDAFKEAFAKTAIGTFGSGWAWLVKKADGSLDLVSTSNAATPLTTDAKPL
LTIDVWEHAYYIDYRNARPKFVEAFWNVVNWDFAAKNFV
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
ttgcggggttattcggtctcgcctacaatcggacgctctgcaggccctagtccctacaca
tacacttcaaaggaatccgtcatggctcatacgctcccgccgctgccctattctgaagac
gcgcttgctccgcacatctcgcaggaaacgatccagttccactacggcaagcaccatcaa
acgtatgtgacgaacctgaacaacctgatcccgggcacggaattcgaaaacctgtcgctc
gaagagaccgtgaagaagtcgtcgggcggtattttcaacaacgctgcgcaaatctggaac
cacacgttcttctggaacagcctgtcgccgaacggcggcggcgctccgacgggcgcgctg
ggcgacgcgatcaacgccaagtggggttcgttcgacgcgttcaaggaagcgttcgcgaag
accgcgatcggcacgttcggctcgggctgggcatggctcgtgaagaaggccgacggctcg
ctcgacctggtctcgaccagcaacgccgccacgccgctgacgaccgacgcgaagccgctg
ctgacgatcgacgtgtgggaacacgcgtactacatcgactaccgcaacgcgcgtccgaag
ttcgtcgaagcgttctggaacgtcgtgaactgggacttcgccgcgaagaacttcgtctaa

DBGET integrated database retrieval system