KEGG   Burkholderia plantarii PG1: BGL_1c33750Help
Entry
BGL_1c33750       CDS       T03632                                 

Gene name
hbd5
Definition
(GenBank) 3-hydoxyacyl-CoA dehydrogenase, NAD-binding protein
  KO
K07516  3-hydroxyacyl-CoA dehydrogenase [EC:1.1.1.35]
Organism
bgp  Burkholderia plantarii PG1
Pathway
bgp00071  Fatty acid degradation
bgp00362  Benzoate degradation
bgp00650  Butanoate metabolism
bgp01100  Metabolic pathways
bgp01120  Microbial metabolism in diverse environments
bgp01200  Carbon metabolism
bgp01212  Fatty acid metabolism
Module
bgp_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bgp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BGL_1c33750 (hbd5)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BGL_1c33750 (hbd5)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BGL_1c33750 (hbd5)
Enzymes [BR:bgp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     BGL_1c33750 (hbd5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 F420_oxidored FAD_binding_3 ApbA NAD_binding_7 TrkA_N Methyltransf_11 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AJK47849
UniProt: A0A0B6S0F7
LinkDB All DBs
Position
1:complement(3876643..3878772)
Genome map
AA seq 709 aa AA seqDB search
MSTPLPSASGTVTRERRDKVLVVTVDHPPVNALSAEVRRGLADAFDAAAADAAVAAVLIV
GAGRNFIAGADIREFGQPPQPPALPDVCRRIEDSAKPVVVALHGATLGGGLEVALAAHYR
IALPGATLGLPEVLLGLLPGAGGTQRAPRLIGAAAALDLMLSGRHVGAEAALGLGLVDRV
AASDDTLAEGLAYTHELLAAAAPVRRTRDAQGLADRAAAEAAIEAARAELARRARGLFSP
QRIVEAVQAALTLSFDAGLQRERELFMACLDSPQRAGLVHAFFAEREAAKAPGAAGAVAR
PVERVGVVGGGTMGAGIAVAVLDAGLPVTMIERDAASLERGRAHVAKVYDALVAKGRLTA
EARDARLARLTGSTAYDALADADLVIEAVFEEMAVKQAVFAELARVTKPGAVLATNTSYL
DIDALAATTGARAGDVIGLHFFSPAHRMKLLEIVVPARVSAEVVATAFGFAKRLRKVAVR
AGVCDGFIGNRLLAVYRAAADYLMEDGASPYEIDAAIRGFGFPMGPYQVIDLAGGDIGWA
TRKRRAATRDPALRYVAIADRLCERGWFGQKTQRGFYRYPDGARGGQPDPEVEAIVAAER
AAKGIVPRAFDADEIVRRYLAAMINEAANVLHEKIALRPLDVDVVLVHGYGFPRHRGGPL
HHADTLGLAEVLADIRRYAAEDPVFWRPSPLLVELAERGETFASLNRAG
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgtccacgccgcttccgtccgcctccggcaccgtcacgcgcgagcgtcgtgacaaggtg
ctcgtcgtcaccgtcgatcatccgcccgtcaacgcgctgtccgccgaggtgcggcgcggc
ctcgcggacgcgttcgacgcggccgccgccgatgccgccgtggcggcggtgctgatcgtc
ggcgcgggccgcaacttcatcgccggtgccgacatccgcgaattcggccagccgccgcag
ccacccgcgctgcccgacgtgtgccgccgcatcgaggacagcgcgaagccggtggtggtg
gcgctgcacggcgcgacgctcggcggcggcctcgaggtggcgctcgccgcgcactaccgg
atcgcgctgccgggcgccacgctcggcctgcccgaggtgctgctcgggctgctgcccggc
gccggcggcacccagcgcgcgccgcgcctgatcggcgcggccgcggcgctcgacctgatg
ctgagcgggcggcacgtcggcgccgaggccgcgctcgggctcggcctcgtcgatcgcgtg
gccgccagcgacgatacgctggccgaagggctcgcctatacgcacgagctgctggccgcc
gcggcgccggtgcgccgcacgcgcgacgcgcaggggctggccgaccgcgccgcggccgag
gcggcgatcgaggccgcgcgcgccgaactggcgcggcgcgcgcgcgggctgttctcgccg
cagcgcattgtcgaggcggtgcaggcggcgctgacgctgtcgttcgacgccggcctgcag
cgcgagcgcgagctgttcatggcctgcctggacagcccgcagcgcgcgggcctggtccac
gcgttcttcgccgagcgcgaggccgccaaggcgccgggcgccgcgggcgcggtagcgcgg
ccagtcgagcgcgtcggcgtggtgggcggcggcacgatgggcgccggcatcgcggtggcg
gtgctcgacgccgggctgccggtgacgatgatcgagcgcgacgcggcctcgctcgaacgc
ggccgcgcccacgtcgcgaaggtctacgacgcgctggtcgcgaaagggcggctcaccgcc
gaggcgcgcgacgcgcggctcgcgcgcctgaccggcagcaccgcctacgacgcgctcgcc
gatgccgatctcgtgatcgaggcggtgttcgaggagatggccgtcaagcaggccgtgttc
gccgaactcgcgcgcgtcacgaagccgggcgcggtactcgccaccaacacctcgtatctc
gacatcgacgcgctggccgccaccaccggcgcgcgcgcgggcgacgtgatcggcctgcac
ttcttctcgcccgcgcatcggatgaagctgctcgagatcgtcgtgccggcgcgcgtgagc
gccgaggtggtggccaccgcgttcggtttcgcgaagcggctgcgcaaggtggcggtgcgc
gcgggcgtctgcgacggcttcatcggcaaccggctgctggcggtgtaccgcgcggcggcc
gactacctgatggaggacggcgcgtcgccgtacgagatcgacgcggcgatccgcggcttc
ggcttcccgatgggaccgtatcaggtgatcgatctggcgggcggcgacatcggctgggcc
acccgcaagcgccgcgcggccacgcgcgatccggcgctgcgctatgtggcgatcgccgac
cggctctgcgagcgcggctggttcgggcagaagacgcagcgcggcttctaccgctacccg
gacggcgcgcgcggcggccagcccgatccggaagtggaggcgatcgtcgcggccgagcgc
gcggccaagggcatcgtgccgcgcgcgttcgacgccgacgagatcgtgcgccgctacctg
gccgcgatgatcaacgaggcggccaacgtgctgcacgagaaaatcgcgctgcgcccgctc
gacgtggacgtggtgctggttcacggctatggttttccgcgccatcgtggcggcccgctc
caccatgccgacacgctcggtctcgccgaggtgctggccgatattcgccgctacgccgcc
gaggatccggtgttctggcgcccctcgccgctgctggtggagctggccgaacgcggcgag
accttcgcgagcctcaatcgcgccggctga

DBGET integrated database retrieval system