KEGG   Burkholderia plantarii PG1: BGL_1c33870Help
Entry
BGL_1c33870       CDS       T03632                                 

Gene name
dacC
Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase DacC
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
bgp  Burkholderia plantarii PG1
Pathway
bgp00550  Peptidoglycan biosynthesis
bgp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgp00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BGL_1c33870 (dacC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bgp01002]
    BGL_1c33870 (dacC)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bgp01011]
    BGL_1c33870 (dacC)
Enzymes [BR:bgp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BGL_1c33870 (dacC)
Peptidases and inhibitors [BR:bgp01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   BGL_1c33870 (dacC)
Peptidoglycan biosynthesis and degradation proteins [BR:bgp01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   BGL_1c33870 (dacC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: AJK47861
UniProt: A0A0B6S6N3
LinkDB All DBs
Position
1:complement(3890234..3891535)
Genome map
AA seq 433 aa AA seqDB search
MRLSSVGLKSLASSTAFATVARNVALGVVVPAALVTTVAVAQAKPAAKAKAAAAAAEAPT
GAPATYLPGAVPPPGVNARSWVLVDASSNQVLASGNADERVEPASLTKLMTAYLVFEALS
TKKISMEQVVTPSEAVRRVGTDESRMFIEANKPVSVHDLVYGMIIQSGNDAAIALAELVG
GSESQFVNMMNAEAQKLGMKGTHFADVNGMPDPQHYTTAGDLAVLSARLIRDFPDYYNIF
SVKEFTYNNIRQPNRNRLLWIDPTVDGLKTGHTQAAGYCLIASAKRPLPGSDASRRLVSV
MMGETRESDRVQDSLKMLNYGYSAFDTVRLYKGGQAVDTPRVYKGRANSVQVGVQKDQFV
TLPKGAGDKIKPQVTLNTPIIAPLAEGQQVGTVQFVADGKTVAQFPVVALQAVPEAGFFG
RLWDSILLMFSKK
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttgtcctccgtaggcctcaagtccctcgcttcttccaccgctttcgccaccgtc
gcgcgcaacgtcgcgctcggcgtcgtcgtgcccgccgcgctcgtgacgacggtcgccgtc
gcgcaggcaaagcccgccgccaaggcgaaggccgccgcggcggccgccgaggcgccgacc
ggcgcgccggccacctatctgccgggcgcggtaccgccgcccggcgtgaacgcgcgctcg
tgggtgctggtcgacgcgagcagcaaccaggtgctcgcctccggcaacgcggacgagcgc
gtcgagcccgcctcgctgaccaagctgatgacggcctacctggtgttcgaggcgctctcg
accaagaagatctcgatggagcaggtcgtgacgccgagcgaggcggtgcgccgcgtcggc
accgacgagtcgcgcatgttcatcgaggcgaacaagccggtgtcggtccacgacctcgtc
tacgggatgatcatccagtcgggcaacgacgccgcgatcgcgctggccgagctggtcggc
ggcagcgaatcgcagttcgtcaacatgatgaacgccgaggcgcagaagctcggcatgaag
ggcacccacttcgccgacgtgaacggcatgcccgatccgcagcactacaccacggcgggc
gacctcgccgtgctgtcggcgcgcctgatccgcgacttccccgactactacaacatcttc
tcggtgaaggaattcacctacaacaacatccgccagccgaaccgcaaccggctgctgtgg
atcgacccgaccgtggacggcctgaagaccggccacacgcaggccgccggttactgcctg
atcgcctcggccaagcgcccgctgccgggctccgacgcctcgcgccgcctcgtgtcggtg
atgatgggcgagaccagggaaagcgaccgcgtgcaggacagcctgaagatgctgaactac
ggctacagcgcgttcgacacggtgcgtctctacaagggcggccaggcggtcgatacgccg
cgcgtctacaagggccgggcgaactcggtgcaggtcggcgtgcagaaggaccagttcgtg
acactgcccaagggcgcgggcgacaagatcaagccgcaggtcacgctgaacacgccgatc
atcgcgccgctcgccgaaggccagcaggtcggcacggtgcagttcgtggcggacggcaag
acggtcgcgcagttcccggtcgtcgcgctgcaggcggtgccggaagcgggcttcttcggc
cgcctctgggattcgatcctgctgatgttcagcaagaagtaa

DBGET integrated database retrieval system