KEGG   Burkholderia glumae PG1: BGL_2c00310Help
Entry
BGL_2c00310       CDS       T03632                                 

Definition
(GenBank) putative glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bgp  Burkholderia glumae PG1
Pathway
bgp00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bgp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BGL_2c00310
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bgp02000]
    BGL_2c00310
Enzymes [BR:bgp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BGL_2c00310
Transporters [BR:bgp02000]
 Other Transporters
  Pores ion channels [TC:1]
   BGL_2c00310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3 GST_C_6 Tom37 GST_N_4
Motif
Other DBs
NCBI-ProteinID: AJK48131
UniProt: A0A0B6S7A1
LinkDB All DBs
Position
2:complement(35359..35970)
Genome map
AA seq 203 aa AA seqDB search
MKFYHHPLSGHSHRVRLFLSLLGLEHDAIEVDLAAAAHKSPQFLKLNPFGQVPVLVDGET
VIADSNAILVYLARKHGGSQWLPQTPEAEAAVQRWLSVAAGEIAFGPAAARLITVFGSKH
NAEEVIARAHGILKLIDAALAGRDYLADTRPTLADVALYGYVARAPEGNVDLSFYPNVNA
WLRRIEALPGFVEFRKTPVGLAA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaagttctatcaccacccgctgtccggccactcgcatcgcgtgcgtctgttcctgtcg
ctgctcggcctcgagcacgacgcgatcgaggtcgacctggccgccgccgcgcacaagtcg
ccgcagttcctgaagctcaatccgttcggccaggtaccggtgctggtcgacggcgagacc
gtgatcgccgattcgaacgcgatcctcgtctacctcgcgcgcaagcacggcggctcgcag
tggctgccgcaaacgccggaagccgaggccgccgtgcagcgctggctgtcggtggccgcc
ggcgagatcgcgttcggcccggccgccgcgcggctcatcaccgtgttcggctcgaagcac
aatgccgaggaagtgatcgcgcgcgcccacggcatcctcaagctgatcgacgccgcgctc
gcgggccgcgactacctggccgacacgaggccgacgctcgccgacgtcgcgctgtacggc
tatgtcgcgcgcgcgccggaaggcaacgtcgacctgtcgttctatccgaacgtcaacgcc
tggctgcgccgcatcgaggcgctgcccggcttcgtcgaattccgcaagacgccggtcggc
ctggccgcctga

DBGET integrated database retrieval system