KEGG   Burkholderia glumae PG1: BGL_2c02710Help
Entry
BGL_2c02710       CDS       T03632                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bgp  Burkholderia glumae PG1
Pathway
bgp00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bgp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BGL_2c02710
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bgp02000]
    BGL_2c02710
Enzymes [BR:bgp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BGL_2c02710
Transporters [BR:bgp02000]
 Other Transporters
  Pores ion channels [TC:1]
   BGL_2c02710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C_3 GST_C_2 GST_C
Motif
Other DBs
NCBI-ProteinID: AJK48367
UniProt: A0A0B6RST5
LinkDB All DBs
Position
2:complement(315081..315809)
Genome map
AA seq 242 aa AA seqDB search
MQYELHYWPTIQGRGEYVRLALEAAGADYVDVAREHGGNGHGVAALMDLLDSRSLDTPPF
APPFLKAGEQIIGQTPNILLFLGARHQLAPKDEAGRLWAHQLQLTVADFVTEIHDTHHPI
ASDLYYEDQKAEAAMRAEDFIKHRLPKFLGYFDRVREQNPHQGGYMVGSQLSYVDLSIFQ
LIEGLRYAFPKATARVEKQHAGLTAIRDRVAEHPPIARYLASERRIPFNKEGIFRHYPEL
DH
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgcaatacgaactccattactggcccaccatccagggccgcggtgaatacgttcggctg
gcactcgaagcggccggggcggactacgtggacgtcgcgcgcgagcacggcggcaacggc
cacggcgtggcggcactgatggacctgctcgacagccgctcgctcgacacgccgccgttc
gcgccgccgttcctgaaggcgggcgagcagatcatcggccagaccccgaacatcctgctg
ttcctcggcgcgagacatcagctcgcgccgaaggacgaagcgggccggctctgggcacac
caattgcaactgaccgtggccgatttcgtcaccgagatccacgacacccaccacccgatc
gcctcggacctctattacgaggaccagaaagccgaggcggcgatgcgcgccgaggatttc
atcaagcaccggctgcccaagttcctcggctatttcgaccgcgtgcgcgagcagaacccg
caccagggcggctacatggtgggcagccagctgagctacgtggacctgtcgatcttccag
ctgatcgaaggcctgcgctacgcgttcccgaaggccaccgcgcgcgtcgagaagcagcac
gcgggcctcaccgcgatccgcgaccgcgtggccgagcatccacccatcgcacgctatctg
gcctcggagcggcgcatcccgttcaacaaggaagggatcttccggcactacccggaactc
gaccactga

DBGET integrated database retrieval system