KEGG   Burkholderia glumae PG1: BGL_2c04100Help
Entry
BGL_2c04100       CDS       T03632                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
bgp  Burkholderia glumae PG1
Pathway
bgp00250  Alanine, aspartate and glutamate metabolism
bgp00410  beta-Alanine metabolism
bgp00640  Propanoate metabolism
bgp00650  Butanoate metabolism
bgp01100  Metabolic pathways
bgp01120  Microbial metabolism in diverse environments
Module
bgp_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:bgp00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BGL_2c04100
   00650 Butanoate metabolism
    BGL_2c04100
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BGL_2c04100
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BGL_2c04100
Enzymes [BR:bgp01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BGL_2c04100
Amino acid related enzymes [BR:bgp01007]
 Aminotransferase (transaminase)
  Class III
   BGL_2c04100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AJK48501
UniProt: A0A0B6S8B6
LinkDB All DBs
Position
2:complement(498712..499995)
Genome map
AA seq 427 aa AA seqDB search
MKNADLQARKNAATPRGVGVMCDFYAARAENAELWDVEGRRFIDFAAGIAVMNTGHRHPK
LVKAIAAQLEQFTHTAYQIVPYASYVELAEKIIARAPGSFAKKAAFFTTGAEAVENAVKM
ARAFTGRPGVIAFAGGFHGRTMMGMALTGKVAPYKLNFGPFPGDVFHAPYPNALHGVSVA
DSLKAIDLLFKADIDPKRVAAIIFEPVQGEGGFYAAPADFVRGLRGICDEHGIVLIADEV
QTGFARTGKLFAMQHHDVLPDLTTMAKSLAGGMPLSGVVGRADVMDAAAPGGLGGTYAGN
PLAVAAAHAVLDIIDEERLEARAVALGDKLKAKLLALRPEVPQIVDVRGPGAMVAVEFFK
AGTREPDADFTRRVQARALERGLLLLICGVHSNVIRFLFPLTIQDAVFDEALGILDEVLK
ETVGVAA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaatgccgatctgcaagcccgcaagaatgccgccaccccgcgcggcgtcggcgtg
atgtgcgatttctacgccgcgcgcgccgagaacgccgaactgtgggacgtcgagggccgc
cgcttcatcgacttcgcggccggcatcgcggtgatgaacacgggccaccgccatccgaag
ctggtcaaggcgatcgccgcgcaactcgagcagttcacgcacacggcctaccagatcgtc
ccctacgcgtcctacgtcgagctggccgagaagatcatcgcgcgcgcgccgggcagcttc
gcgaagaaggccgcgttcttcacgaccggcgccgaagccgtcgagaacgccgtcaagatg
gcgcgcgcgttcaccggccgccccggcgtgatcgcgttcgcgggcggcttccacggccgc
accatgatgggcatggcgctgaccggcaaggtcgcgccgtacaagctgaacttcgggccg
ttcccgggcgacgtgttccacgcgccctacccgaacgcgctgcacggcgtgagcgtggcc
gactcgctgaaggcgatcgacctgctgttcaaggccgacatcgatccgaagcgcgtggcc
gcgatcatcttcgagccggtgcagggcgaaggcggcttctacgcggcgccggccgatttc
gtgcgcggcctgcgcgggatctgcgacgaacacgggatcgtgctgatcgccgacgaagtg
cagaccggtttcgcgcgcaccggcaagctgttcgcgatgcagcaccacgacgtgctgccc
gacctcaccaccatggccaagagcctcgcgggcggcatgccgctgtcgggcgtggtcggc
cgcgccgacgtgatggacgcggcggcgccgggcggcctcggcggcacctacgcgggcaac
ccgctcgcggtggccgcggcgcacgcggtgctcgacatcatcgacgaggaacggctcgaa
gcgcgcgccgtcgcgctcggcgacaagctcaaggcgaagctgctggcgctccggcccgag
gtgccgcaaatcgtcgacgtgcgcggcccgggcgcgatggtggccgtcgagttcttcaag
gccggcacgcgggagccggacgcggacttcaccaggcgcgtgcaggcgcgcgcgctcgaa
cgcgggctgctgctgctgatctgcggcgtccattcgaacgtgatccgcttcctgttcccg
ctgacgatccaggacgccgtgttcgacgaagcgctcggcatcctcgacgaagtgctgaag
gaaaccgtcggcgtcgccgcctga

DBGET integrated database retrieval system