KEGG   Burkholderia plantarii PG1: BGL_2c09490Help
Entry
BGL_2c09490       CDS       T03632                                 

Definition
(GenBank) tetratricopeptide repeat protein, O-GlcNAc transferase-like protein
  KO
K09667  protein O-GlcNAc transferase [EC:2.4.1.255]
Organism
bgp  Burkholderia plantarii PG1
Brite
KEGG Orthology (KO) [BR:bgp00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    BGL_2c09490
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bgp01003]
    BGL_2c09490
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bgp03036]
    BGL_2c09490
Enzymes [BR:bgp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.255  protein O-GlcNAc transferase
     BGL_2c09490
Glycosyltransferases [BR:bgp01003]
 O-Glycan biosynthesis
  O-linked GlcNAc type
   BGL_2c09490
Chromosome and associated proteins [BR:bgp03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    NSL complex
     BGL_2c09490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_1 Glyco_transf_41 TPR_2 TPR_11 TPR_16 TPR_12 TPR_8 TPR_7 TPR_14 TPR_19 TPR_17 TPR_10 TPR_6 TPR_4 TPR_9 ANAPC3 TPR_21 BTAD Coatomer_E TPR_20 Wzy_C_2
Motif
Other DBs
NCBI-ProteinID: AJK49027
UniProt: A0A0B6RUK6
LinkDB All DBs
Position
2:complement(1193766..1196267)
Genome map
AA seq 833 aa AA seqDB search
MLWSGGIRPSRRGRGLPSPDRLIERRTAPRRRRRRNSFPGRQTMESNQMLALAMAHHGAG
RLDEARELYERALTGAVDEANVMFRLGVLNLQRGAHETALGWLDRALAHAPDNVRYHLAR
GHVFTATQCFVEAIDAYQRALALDARSVDALFALATTLQAVAETAAAVEVYAALLAIDPA
HADALNNLGNCHRQQGDAPAAEAVYRQAVALHPGDANALTNLATLVLAAGRTDEAVTLLE
AAVQAAPDWPCGLANLGVALHRGGDFAGSAARLARALELDPAFPEADYNLANALHALGRR
PEALVHYRRAIGQVPAHADACNNLGIVHRESGQLHEAADAFRAAIGLRPDFLAALNNLAV
VLRTLGAMDEAEAHLRRALAVDPHHAVTHNNLGNVLKDQGRLDEGIDSYRRALASDPDNV
LAHGNLVYALSFQADQPGPILEECRRWSARHEAPLRAARQPHPNDATPARRLRVGYVSPD
FRNHCQTLFTLPLLAHHDHRHFEVFCYASVARPDDLTRRLAAHADVWRDVSRLDDERLAR
TIRDDRIDILIDLSMHMADSRPLLFARRPAPVQIAWLAYPGTTGIDAIDYRLTDPWLDPA
GADAWYTERSIRLPDSFWCYDPLADTPAVNALPALANGYPTFGCLNNPCKLGDASFRLWG
AVMRSLPDARLILMAPDGSARARLLDKLARYGIAAGRVAFTPFRPRADYLQTYHQIDIGL
DTIPYNGHTTSLDSYWMGVPVVTRIGDTVVGRAGLSQSTNLGLGEVVADSDARFVEIAVE
LAGDLPRLGAMRASLRERLAASPLMNGPRFATHIEAAYREAWRHWCDGARNAG
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
ttgctatggtccggcggaatccgcccgtctcgacgcggccgcggcttgccgtccccggat
cgcttgatcgaacggcggaccgcgccgcgacggcgccgtcgacgcaacagtttccccggc
aggcaaacgatggaaagcaaccagatgctggcactcgcgatggcgcaccatggcgcgggc
cggctcgacgaagcgcgcgagttgtacgaacgcgcgctgacaggcgccgtggacgaggcg
aacgtgatgttccgtctcggcgtgctgaacctgcaacgcggcgcccacgagacggcgctc
ggctggctcgaccgcgcgctggcccatgcgcccgacaacgtccgctaccacctcgcgcgc
gggcacgtattcaccgccacgcaatgcttcgtcgaggcgatcgatgcctaccagcgggcg
ctggcgctcgacgcccgctcggtcgatgcattgttcgcgctggccacgaccttgcaggcc
gtggcggagaccgccgccgccgtcgaggtctacgccgcgctgctggccatcgacccggcg
cacgccgacgccctcaacaatcttggcaactgccaccgccagcaaggcgacgcgcccgcg
gccgaggccgtctaccggcaggccgtcgcactgcatccgggcgacgccaacgcgctgacg
aatctcgccacgctggtgctggcggccggccggaccgatgaggccgtgacgctgctcgaa
gccgcggtacaggccgcgcccgactggccatgcggcctcgcgaacctgggcgtcgcgctg
catcgcggcggcgacttcgcgggcagcgcggcccggctcgcgcgcgccctggaactggac
ccggccttccccgaagccgactacaacctggccaacgcgctgcacgcgctcggccggcgg
cccgaggcgctggtccactaccggcgcgcgatcgggcaggtgcccgcgcatgccgatgcc
tgcaacaatctcggcatcgtccatcgcgaatcggggcagctgcacgaggcggccgacgcg
tttcgcgccgcgatcggcctgcggcccgactttctcgccgcgctcaacaacctcgccgtg
gtgctgcgcacgctcggcgcgatggacgaggccgaggcgcatctgcgccgcgcgctcgcg
gtcgatccgcaccatgccgtcacgcacaacaatctgggcaacgtgctgaaggaccagggg
cgcctcgacgagggcatcgacagctatcgccgcgcgctcgccagcgatcccgacaacgtc
ctcgcgcacggcaatctggtctacgcgctgtcgttccaggccgaccagcccgggccgatc
ctcgaggaatgccgccgctggtcggcgcgacatgaagcgccgctgcgcgccgcgcgccag
ccgcatccgaacgacgcgacgcctgcgcgccggctgcgcgtcggctacgtatcgccggac
ttccgcaaccactgccagacgctgttcacgctgccgctgctcgcgcatcacgatcaccgg
catttcgaggtcttctgctacgcgagcgtcgcgcggcccgacgacctgacccggcgcctc
gccgcccacgccgacgtctggcgcgacgtgagccggctcgacgacgaacggctcgcccgc
acgattcgcgacgaccggatcgacatcctgatcgacctgagcatgcacatggccgacagc
cggccgctgctgttcgcgcggcgcccggcgccggtgcagatcgcgtggctggcctatccc
ggcaccaccggcatcgacgcgatcgactaccggctgaccgacccgtggctcgatccggcc
ggcgccgacgcctggtacaccgagcgctcgatccgcctgcccgattcgttctggtgctac
gacccgctggcggacacgccggccgtcaacgcgctgcccgcgctcgccaacggctatccg
accttcggctgcctgaacaatccgtgcaagctcggcgacgcctcgttccggctatggggc
gccgtgatgcgctcgctgccggacgcccggctgatcctgatggcgcccgacggctcggct
cgcgcgcgcctgctcgacaagctggcccggtacggcatcgcggccgggcgggtcgcgttc
acgccgttccggccgcgcgccgactatctgcagacgtatcaccagatcgacatcgggctc
gacacgattccgtacaacggccacaccacgagcctcgattcgtactggatgggggtgccg
gtcgtcacgcgaatcggcgacacggtggtgggacgcgccggcctgagccagtcgacgaac
ctggggctgggcgaggtggtggccgacagcgacgcgcgcttcgtcgagatcgccgtcgaa
ctggcgggcgacctgccgcggctcggcgcgatgcgggcgagcctgcgcgagcggctcgcg
gcctcgccgctgatgaacggcccgcgcttcgcgacgcatatcgaggcggcgtatcgcgag
gcgtggcggcattggtgcgacggggcgcgcaacgccggatga

DBGET integrated database retrieval system