KEGG   Burkholderia plantarii PG1: BGL_2c11490Help
Entry
BGL_2c11490       CDS       T03632                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulfideoxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bgp  Burkholderia plantarii PG1
Brite
KEGG Orthology (KO) [BR:bgp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BGL_2c11490
Enzymes [BR:bgp01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BGL_2c11490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 FAD_oxidored Thi4 FAD_binding_3 HI0933_like Glutaredoxin DAO AlaDh_PNT_C K_oxygenase NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AJK49227
UniProt: A0A0B6RV43
LinkDB All DBs
Position
2:complement(1431614..1433278)
Genome map
AA seq 554 aa AA seqDB search
MRPPRRTPPRPPARCQKHYGIRIIMLDANLKNQLKSYLDKITRPIELVASLDDGAKSKEL
IELLNEIGSLSPRVTVVERRDDAERKPSFSIGEPGKPTGIRFAGIPMGHEFTSLVLALLQ
VGGHPLKLDDATIEQIRNLEGDFSFETYFSLTCQNCPEVVQALNVMALLNPRIRHVAIDG
ALFQNEVDERQIMAVPTMFVNGEHFGQGRSSVKEILAKLDTGASARAAKELDKKDVFDVL
IVGGGPAGAAAAIYAARKGIRTGVVAERFGGQVLDTMAIENFVSVQETEGPKFAVALEQH
VKQYEVDIMDVQRATALVPGAINEIRLESGATLKAKSVILSTGARWRELNVPGEREYRNK
GVAYCPHCDGPLFKGKHVAVVGGGNSGVEAAIDLAGIVREVTLIEFGDALRADEVLQRKL
RSLKNVTIITSAQTKELLGDGQKVNGLVYLERTTGETKRIELEGVFVQIGLVPNTEWLKG
TIELSKHGEIVVDARGATSLPGVFAAGDVTTVPYKQIVIAVGEGAKASLSAFDYLIRQDV
EAPVAAKVGEAVAA
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
gtgcggcccccgcgccgcacgccccctcgccctccggcgaggtgccaaaaacattacgga
atccgaatcatcatgctcgacgccaatctcaagaaccagttgaagtcgtacctcgacaag
atcacccgcccgatcgaactcgtcgcctcgctcgatgacggcgccaagtcgaaggagctg
atcgagctgctgaacgagatcggctcgctgtcgccgcgcgtcaccgtcgtggaacgccgc
gacgacgccgaacgcaagccgtcgttctcgatcggcgagcccggcaagcccaccggcatc
cgcttcgcgggtatcccgatggggcatgaattcacctcgctcgtgctcgcgctgctgcag
gtgggcggccatccgctcaagctcgacgacgcgacgatcgaacagatccgcaacctcgaa
ggcgatttctccttcgagacgtatttctcgctgacctgccagaactgcccggaagtcgtg
caggcgctgaacgtgatggcgctcttgaacccgcgcatccgccacgtggcgatcgacggc
gcgctgttccagaacgaagtggacgaacggcagatcatggccgtgccgaccatgttcgtg
aacggcgagcatttcggccagggccgcagcagcgtcaaggaaatcctcgcgaagctcgac
accggcgccagcgcccgggccgcgaaggaactggacaagaaggacgtgttcgacgtgctg
atcgtcggcggcggcccggccggcgcggcggccgcgatctacgcggcgcgcaagggcatc
cgcaccggcgtggtggccgagcgtttcggcggccaggtgctcgacacgatggcgatcgag
aacttcgtctccgtgcaggaaaccgaagggccgaagttcgcggtcgcgctcgaacagcac
gtcaagcagtatgaagtcgacatcatggacgtgcagcgcgccaccgcgttggtgccgggg
gcgatcaacgagatccgcctagaaagcggcgcaacgctgaaggcaaagtcggtgatcctc
tcgacgggtgcccgctggcgcgaactgaacgtgccgggcgaacgcgaataccgcaacaag
ggcgtggcctactgcccgcactgcgacggcccgctgttcaagggcaagcacgtggccgtg
gtgggcggcggcaactcgggcgtggaagccgcgatcgacctggccggcatcgtccgtgaa
gtgacgctgatcgagttcggcgacgcgctgcgcgccgatgaagtgctgcaacgcaagctg
cgcagcctcaagaacgtgaccatcatcaccagcgcgcagaccaaggagctgctcggcgac
ggccagaaggtgaacggcctcgtctacctggagcgcacgaccggcgaaacgaagcgcatc
gaactggaaggcgtgttcgtgcagatcggcctggtgccgaacacggaatggctgaagggc
acgatcgagctgtcgaagcacggcgagatcgtggtcgatgcgcgcggcgccacctcgctg
ccgggcgtgttcgccgccggcgacgtgaccacggtgccgtacaagcagatcgtgatcgcg
gtcggcgaaggcgcgaaggcctcgctgtcggccttcgattacctgatccgccaggacgtc
gaggcgcccgtcgccgcgaaggtcggcgaagccgtcgccgcctga

DBGET integrated database retrieval system