KEGG   Burkholderia plantarii PG1: BGL_2c11770
Entry
BGL_2c11770       CDS       T03632                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bgp  Burkholderia plantarii PG1
Pathway
bgp00440  Phosphonate and phosphinate metabolism
bgp00998  Biosynthesis of various secondary metabolites - part 2
bgp01100  Metabolic pathways
bgp01110  Biosynthesis of secondary metabolites
bgp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bgp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BGL_2c11770
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    BGL_2c11770
Enzymes [BR:bgp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     BGL_2c11770
SSDB
Motif
Pfam: PEP_mutase NTP_transf_3 PEP_hydrolase ICL IspD Ribul_P_3_epim NTP_transferase
Other DBs
NCBI-ProteinID: AJK49255
UniProt: A0A0B6S7J8
LinkDB
Position
2:complement(1463527..1465212)
AA seq 561 aa
MNAREPNFTESRAARLRRMLTSNELEFLMEAHNGLSAKIVREAGFKAIWGSGLSISAALG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNMRRLVRKLEQRGIAGVCIED
KQFPKTNSFIDGERQPLAEIDEFAGKIKAGKDSQHDPDFSIVARVEALIAGWGMDEALRR
AHAYADAGADAILIHSKLSRPDEILQFAREWGNRAPLVIVPTKYYSTPTDVFRQAGISTV
IWANHLVRSSAAAMQATAREIFESETLVNVEDRVATVNEIFRLQDADEYSAAERLYLSSS
SRSSNSALVLAASRGSGLEAVTEDRPKVMLPIAGKPLLRWLVDGFKKEGVNDITVVGGYR
ADAIDKSGIKLVVNERHAETGELASLACAAGKISGDTVISYGDLLFRSYILRDLAESDAE
FTVVVDSSLTDSPNQSVHDFALCSAADDRGLFGQKITLRRVASDAGNGAPHGRWVGLLNV
RGAGVERLKAMIATLQARPDFDQLDIPALLNALVDAGEQIAVQYVHGHWRGVNDLDEFRR
AGDFAHGQTPLASGTAVGDAQ
NT seq 1686 nt   +upstreamnt  +downstreamnt
atgaacgcacgcgaacccaacttcaccgaatcccgcgccgcgcggctgcggcgcatgctg
acgagcaacgagctcgaattcctgatggaagcgcacaacggcctgtccgcgaagatcgtg
cgcgaggccggcttcaaggcgatctggggctcgggcctgtcgatctccgccgcgctcggt
gtgcgcgataacaacgaagcgagctggacccaggtggtcgacgtgctcgaattcatggcc
gacgcgagcgacctgccgatcctgctcgacggcgacaccggctacggcaacttcaacaac
atgcgccgcctggtgcgcaagctcgagcagcgcggcatcgccggcgtctgcatcgaggac
aagcagttcccgaagaccaacagcttcatcgacggcgaacgccagccgctcgccgagatc
gacgagttcgcgggcaagatcaaggccggcaaggattctcagcacgatccggacttctcg
atcgtggcgcgcgtcgaggcgctgatcgcgggctggggcatggacgaggcgctgcgccgc
gcgcatgcctacgccgatgccggcgccgacgcgatcctgatccacagcaagctgtcgcgc
ccggacgagatcctccagttcgcgcgcgaatggggcaaccgcgcgccgctcgtgatcgtg
ccgaccaagtactacagcacgccgaccgacgtgttccgccaggccggcatcagcaccgtg
atctgggcgaaccatctggtccgctcgtcggccgcggcgatgcaggccaccgcgcgcgag
atcttcgagagcgagacgctcgtcaacgtcgaggatcgcgtggccaccgtcaacgagatc
ttccgcctgcaggacgccgacgaatactcggccgccgagcgcctctacctgtcgtcgtcg
tcgcgctcgtcgaactcggcgctggtgctcgcggcgagccgcggctcgggcctcgaggcc
gtcaccgaggacaggccgaaggtgatgctgccgatcgccggcaagccgctcctgcgctgg
ctggtggacggcttcaagaaggaaggcgtgaacgacatcacggtggtgggcggctaccgc
gccgacgcgatcgacaagtccggcatcaagctggtggtcaacgagcgccacgccgagacg
ggcgagctcgcctcgctggcctgcgcggccggcaagatcagcggcgacaccgtgatctcc
tacggcgacctgctgttccgcagctacatcctgcgcgacctggccgagagcgacgccgag
ttcacggtggtggtggattcgtcgctgaccgattcgccgaaccagagcgtgcatgacttc
gcgctgtgctcggccgccgacgaccgcggcctgttcggccagaagatcacgctgcggcgc
gtggcgagcgacgccggcaacggcgcgccgcacggccgctgggtcggcctcctgaacgtg
cgcggcgcgggcgtcgaacgcctgaaggcgatgatcgcgacgctgcaggcacgccccgac
ttcgaccagctcgacatcccggcgctgctcaacgcgctggtggacgccggcgagcagatc
gcggtgcagtacgtccacggccactggcgcggcgtgaacgacctcgacgaattccgtcgc
gcgggcgacttcgcgcacggccagacgccgctcgcgagcggcacggcggtcggggacgcg
caatga

DBGET integrated database retrieval system