KEGG   Burkholderia glumae PG1: BGL_2c13560Help
Entry
BGL_2c13560       CDS       T03632                                 

Definition
(GenBank) ROK domain containing protein
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
bgp  Burkholderia glumae PG1
Pathway
bgp00010  Glycolysis / Gluconeogenesis
bgp00520  Amino sugar and nucleotide sugar metabolism
bgp01100  Metabolic pathways
bgp01110  Biosynthesis of secondary metabolites
bgp01120  Microbial metabolism in diverse environments
bgp01130  Biosynthesis of antibiotics
bgp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bgp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BGL_2c13560
   00520 Amino sugar and nucleotide sugar metabolism
    BGL_2c13560
Enzymes [BR:bgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     BGL_2c13560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AJK49423
UniProt: A0A0B6S1A3
LinkDB All DBs
Position
2:1702855..1703652
Genome map
AA seq 265 aa AA seqDB search
MKPSKKPSTKPHDANDAADSSGGGRILSIDIGGSGLKAAIVDTRANMLGKRVRVETPHPC
PPGLLVDTLHALVAPLIASHAPSRVSIGFPGFVRDNRVLTAPHIGPDGWRDVPLAAMLGE
RLGIDAVRMINDAEMQGLAAIEGHGLEFVLTLGTGAGTALFRDGELMPHLELAHHPVSKK
HAYDEYIGDAARRKAGNKRWSRRVGKVIDILESLVHYDRLWIGGGNAARLKLALPPNVAT
VPNDRGIEGGALLWHPRSVREARRG
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgagcaagaaacccagcacgaaaccccatgacgcgaacgacgcggccgattcc
agcggcggcgggcgcatcctctcgatcgacatcggcggcagcgggctgaaggcggccatc
gtcgacacccgggcgaacatgctcggcaagcgcgtgcgcgtggagacgccgcatccgtgc
ccgccggggctgctggtcgatacgctgcacgcgctcgtcgcgccgctgatcgcaagccat
gcgccgtcgcgcgtgtcgatcggctttcccggcttcgtgcgcgacaaccgcgtgctgacc
gcgccgcacatcggcccggacggctggcgcgacgtgccgctcgcggcgatgctcggcgag
cggctcggcatcgacgcggtgcgcatgatcaacgacgcggagatgcagggcctggccgcg
atcgaggggcacggcctcgaattcgtgctgacgctcggcaccggcgccggcacggcgctg
ttccgcgacggcgagctgatgccgcatctcgagctcgcgcatcatccggtcagcaagaag
cacgcgtatgacgaatacatcggcgacgcggcgcgccgcaaggccggcaacaagcgctgg
agccggcgcgtcgggaaggtcatcgacatcctcgaatcgctcgtgcattacgacaggctg
tggatcggcggcggcaatgccgcccggctgaagctggcgctgccgccgaacgtggcgacg
gtgccgaacgatcgcggcatcgagggcggggcgctgctgtggcatccgcgctcggtgcgg
gaagcgcggcggggctga

DBGET integrated database retrieval system