KEGG   Burkholderia plantarii PG1: BGL_2c18170Help
Entry
BGL_2c18170       CDS       T03632                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur protein SdhB
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bgp  Burkholderia plantarii PG1
Pathway
bgp00020  Citrate cycle (TCA cycle)
bgp00190  Oxidative phosphorylation
bgp00650  Butanoate metabolism
bgp01100  Metabolic pathways
bgp01110  Biosynthesis of secondary metabolites
bgp01120  Microbial metabolism in diverse environments
bgp01130  Biosynthesis of antibiotics
bgp01200  Carbon metabolism
Module
bgp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bgp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bgp_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bgp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BGL_2c18170 (sdhB)
   00650 Butanoate metabolism
    BGL_2c18170 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BGL_2c18170 (sdhB)
Enzymes [BR:bgp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BGL_2c18170 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     BGL_2c18170 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_9 Fer4_7 Fer4_18 Fer4 Fer2 Fer4_4
Motif
Other DBs
NCBI-ProteinID: AJK49883
UniProt: A0A0B6S2L5
LinkDB All DBs
Position
2:complement(2339309..2340010)
Genome map
AA seq 233 aa AA seqDB search
MAKRIFELYRYDPDKDAAPRMQTYEVEIKHERMLLDALVKLKEIDETLSFRRSCREGVCG
SDAMNINGKNGLACLTNLNDLPEKIVLRPLPGLPVVRDLIVDMTHFFNQYHSIKPFLIND
TPPPEKERLQSPEEREELDGVYECILCASCSTSCPSFWWNPDKFVGPAGLLQAYRFIADS
RDEATAERLDNLEDPYRLFRCHTIMNCVDVCPKGLNPTKAIGKIKELMVRRAV
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacgcattttcgaactctatcgttacgatccggacaaggacgcggcgccgcgc
atgcagacgtacgaagtcgagatcaagcatgaacgcatgctgctcgacgcgctcgtcaag
ctgaaggaaatcgacgaaacgctgtcgttccgtcgctcgtgccgcgaaggcgtgtgcggc
tcggacgcgatgaacatcaacggcaagaacggtctggcgtgtctcacgaacctgaacgat
ctgcccgagaagatcgtgctgcgcccgctgccgggcctgccggtggtgcgcgacctgatc
gtcgacatgacgcacttcttcaaccagtaccactcgatcaagccgttcctgatcaacgac
acgccgccgcccgagaaggagcgcttgcagtcgccggaggaacgcgaagagctggacggc
gtgtacgagtgcatcctgtgcgcgagctgctcgacctcctgcccgagcttctggtggaat
ccggacaagttcgtcggcccggccggcctgctgcaggcttaccgcttcatcgccgacagc
cgcgacgaagccaccgccgaacgcctcgacaacctcgaggatccgtaccgtctgttccgt
tgccacacgatcatgaactgcgtcgacgtttgcccgaaggggctgaacccgaccaaggcg
atcggcaagatcaaggaattgatggttcgccgcgcggtctga

DBGET integrated database retrieval system