KEGG   Bartonella grahamii: Bgr_05200Help
Entry
Bgr_05200         CDS       T00922                                 

Gene name
glnE
Definition
(GenBank) glutamate-ammonia-ligase adenylyltransferase
  KO
K00982  [glutamine synthetase] adenylyltransferase / [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase [EC:2.7.7.42 2.7.7.89]
Organism
bgr  Bartonella grahamii
Brite
KEGG Orthology (KO) [BR:bgr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Bgr_05200 (glnE)
Enzymes [BR:bgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.42  [glutamine synthetase] adenylyltransferase
     Bgr_05200 (glnE)
    2.7.7.89  [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase
     Bgr_05200 (glnE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GlnE GlnD_UR_UTase XPC-binding DUF294 Oest_recep
Motif
Other DBs
NCBI-ProteinID: ACS50841
UniProt: C6ACC9
LinkDB All DBs
Position
628414..631359
Genome map
AA seq 981 aa AA seqDB search
MLFKGAQTKQAFLKTQLLPLYPLDKSGSQWLKDMEEQARKEGLESLVSLISESGTQIDFI
SSVMTLSPFLREVLIANPSYLSALLNVDIETRLSEIIDDITAIDKDETINETSLMAALRR
KKREAHVLIALADLSGVFTYEVSCAWLTRLGEAALSVALRFLLREAHDHGKINLLSRENP
EKDCGLIILGMGKLGAGELNYSSDIDLIVFIDETSPHIGNLSESVDVFSKMVRRLIRIIQ
ERTAEGYVFRLDFRLRPDPGSTPLALPVRTALRYYEGRGQNWERAAMIKARPVAGDKRAG
FNFLKELFPYVWRKYLDYAAIADIHSIKRQIHAHKNYGQIAAYGHNIKLGRGGIREIEFF
VQTQQLIAGGRFPQLRGRQTVAMLAELHTLGWISEKTRNSLIKSYAFLRNVEHRIQMLFD
EQTHLLPNDIAQFTSVAYLMGYQDSSSFIRDLLKTLQVVEKHYAALFENEQELGLEIGNL
VFTGEEDDPETLITLSRLGFERASDICRIMRTLHCGRYKATQSAEARERLTELTPALLKA
FGGTKRADEAMLRFDSFLQGLPSGIQLFSLLQSNPSLLDMLVLIMGAAPRLAEIITRRSH
VFDGMLDPNILSELPTKTYLEKRLEYFLENIFPYEEILDHLRIFADEQRFLIGIRILNGA
ITGERAGFAFTALADLMITKTFAAVQEEFSRLHGSVKGGRVGILGMGKLGSRELTADSDV
DLVLLYEHDDDAEISDGEKPLYISQYYTRLAQRLISALSTLTSQGVLYVVDLRLRPLGNK
GPVAVSFPFFKKYYRQEAWIWEYLALTRARGIAGDPDFLQKLENEVCAIIAISRDKKEVA
KEVCEMRSLIAKEKPPKNQWDLKTMSGGIMDLEFIAQFSLITHVIEFQIGATTADILDHL
PNSFLNQSCIADLHYAYRLYTNLSQIIRLCLNDSLDPNNMPPGLSDLLLNSVGEPDLLRV
EKLIAETGQLVCSVFTKIMKH
NT seq 2946 nt NT seq  +upstreamnt  +downstreamnt
atgcttttcaagggagcgcagacgaaacaagcttttttaaaaacacagcttctcccttta
taccctctcgataaaagtggttcccaatggttaaaagacatggaagaacaagcaaggaaa
gaaggtttagaatcgcttgtttcccttatttcagagagtggaacgcagattgattttatc
agttcagttatgaccttatctccttttttgcgtgaggttttaattgccaatccatcatat
cttagtgctttattgaatgttgatatagaaacaaggctgagcgaaattatagatgatatt
acggctattgataaggatgaaactataaatgaaacttcattgatggctgctttaaggcgc
aaaaaacgagaagcgcatgttctcattgctttagctgatttgagtggtgtttttacttac
gaagtttcatgtgcttggttgacacgtttgggtgaagccgcattaagtgtagcgctgcgt
tttctattaagagaagcgcatgatcatggtaagatcaatttattaagccgtgagaatcca
gaaaaagactgtggtttaattattttagggatgggaaaattaggagcaggggaacttaat
tattcttctgatattgatcttattgttttcattgatgaaacatcacctcatattggtaat
ctttctgaaagtgttgacgtattttctaaaatggtacgccgattaatccgtatcattcaa
gaacgcactgcggaaggatatgtttttcgtcttgattttcgtcttcgtccagatccagga
tcaacccctttggccttaccagtaaggactgccttgcggtattacgaagggcgtgggcaa
aattgggaacgagcagccatgattaaagcacgtccagttgctggcgataagagggcaggt
tttaactttcttaaagagctttttccctatgtgtggcggaaatatttagattacgctgct
attgctgatattcattcgatcaaacgtcaaattcatgcgcataaaaattacggtcaaatt
gcagcttatgggcataatataaagttaggtcgtggcggtattcgtgagattgagtttttt
gttcagacacaacagctcattgccggtgggcgttttcctcaattacgtggacgtcagaca
gtggcaatgttagcagaacttcacacgcttggttggatcagtgagaaaaccagaaatagc
cttataaaaagttatgcttttcttcgaaatgtggaacatcgtattcagatgcttttcgat
gaacaaacacaccttcttccaaatgatattgctcaattcacaagtgttgcctatttaatg
ggttatcaagacagcagcagttttatccgtgatttattaaaaacacttcaggttgttgaa
aaacattatgcagcactgtttgagaatgagcaagaacttggtttagaaattggtaattta
gtttttacaggtgaagaagatgatccggagacattaataacgttaagccgtttaggcttt
gaaagagcaagtgatatttgtcgtattatgcgtactctccattgtggtcgttataaagca
acgcaatcagccgaagcacgcgagagattaacggaattaacaccagctcttttgaaagct
tttggtgggacaaaacgagctgatgaggcgatgttgcgttttgatagttttttacagggc
ttaccttcaggaattcagctttttagtcttttgcagtctaatccctctcttttggatatg
cttgtccttattatgggcgctgctccacgtcttgcagaaattattacacgcagatcccat
gtttttgatggaatgttagatccgaatattctttcagaattaccaacaaaaacgtattta
gaaaaacggcttgaatattttcttgaaaatatctttccttatgaggaaattctcgatcat
ttaagaatttttgcagatgaacaacgttttttaattggtattcgaattttgaatggtgca
attacaggagaaagagcgggttttgcttttactgcgcttgctgatcttatgattacaaaa
acatttgctgccgttcaagaggaattttctcgtcttcatggtagtgttaaaggggggcgt
gttggcatattgggtatggggaagcttggaagtcgcgaattgacggcagattccgatgtt
gacctcgttttgctttatgaacacgatgatgatgcagaaatatctgatggagaaaagcct
ctttatatctctcaatattatacgcgtttagcacagcgcctcatttctgctttatccact
cttacaagccaaggtgttctttatgtcgttgatttaaggttacggccgttaggcaataaa
ggacctgttgctgtttcttttccattttttaaaaagtattatcgccaagaagcatggata
tgggaatatcttgctttaacaagggctcgaggcattgcaggagatcctgattttttacaa
aagctagaaaatgaagtgtgtgcaattattgctatttctcgtgataagaaggaagttgca
aaagaagtatgtgaaatgcgttccttgattgcaaaagaaaagccgccaaaaaatcaatgg
gatttaaaaacgatgtctggtggcattatggatttggagtttattgctcaattttctctt
attacgcatgtcattgagtttcaaattggagcaacaacagctgatattttagatcactta
ccaaacagttttcttaatcagtcatgtattgctgatttacattatgcctatcgtctttat
acaaatttgagtcaaattatacggctttgcttaaatgattctcttgatcccaataatatg
ccacctggattaagtgaccttttgttaaatagtgttggggaacctgatttgcttcgtgtt
gaaaagttaattgcagaaactgggcaattggtctgttcagtttttacaaaaatcatgaaa
cattaa

DBGET integrated database retrieval system