KEGG   Borreliella garinii SZ: X921_03095Help
Entry
X921_03095        CDS       T03259                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bgs  Borreliella garinii SZ
Pathway
bgs00564  Glycerophospholipid metabolism
bgs01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bgs00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    X921_03095
Enzymes [BR:bgs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     X921_03095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like Pyr_redox_2 NAD_binding_8 Pyr_redox_3 GIDA Thi4 Pyr_redox FAD_binding_3 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AHZ74299
LinkDB All DBs
Position
complement(653517..655106)
Genome map
AA seq 529 aa AA seqDB search
MEEYLNFMNNNKETKLKNLENQEFDLIIIGGGATGLGIAVDAITRGYKVILIEKFDYAKG
TSSRSSKLIHGGVRYLAQWNISLVKEALHEKAILEKNAPHLINECAFITPIYNILKIPYY
YLGLTYYHNLMGKEKATKYKTKLLSKKSTIEKAPNIKTEGLKCSVLYYDDSFDDARMAIT
LLRTFTEKGGIALNYTELVQFNKENGKLSGVLIQNKLSKEQISLKSKCIINATGIFSDEI
RRLDDEKALNIIKPSQGSHLIIKKDKFPQNHAILIPKTSDNRILFAIPWYDGVVCGSTDI
PIKEVEVEPKRLDEEIDFIINNLNNYLNIKIEKSDVKSVYTGIRPLIMDPKAEGNTSKIS
RNEKIFISDSNLITIAGGKYTTYRKMAEKTLLKAIEKNLLPNYPPTTEDLKLHGYLKKEA
AVKIPEPFRTYGSDFEILKNMEGFDKKIHESLDLNEAQIAFSIEFEQAKTIDDVLARRTR
SLPLNPQAAIEAAPRVAEIMMKKLNKSEKWKNEQIKTFLEISKKYLIKN
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggaggaatatttaaatttcatgaataataacaaagaaacaaaattaaaaaatcttgaa
aatcaagaatttgatctcataataattggaggaggcgcaacaggtcttggtatcgcagta
gacgcaatcacaaggggatataaagtaatacttatagaaaaatttgactacgcaaaagga
acttcctctagatcaagcaaattaattcacggtggagtaagatatttagctcaatggaat
atttctttggttaaagaagctttacatgaaaaagcaattcttgaaaaaaatgcacctcat
ttaattaacgaatgtgcatttattacccctatttataatatcttaaaaataccttattat
tatttgggattaacttattaccacaatcttatgggtaaagaaaaagctaccaaatataaa
actaaattactatccaaaaaatctaccattgaaaaagctcctaatattaaaacagaaggc
cttaaatgctctgttttatattacgatgattcattcgatgatgctagaatggcaataaca
ttattaagaacttttaccgaaaaaggaggaattgcccttaactacacagagcttgtacaa
tttaacaaggaaaacggaaaactttcaggggttttaatacaaaataaattgtccaaagaa
caaatttcattaaaaagtaaatgtataataaacgcaacaggaatattttcagatgaaata
agaagattggatgatgaaaaagctttaaacattatcaaaccttcccaaggtagccattta
ataatcaaaaaagacaaattcccccaaaatcatgcaatattaatacctaaaactagtgat
aataggattttattcgctattccttggtatgatggcgtcgtttgtggaagtaccgacatt
ccaataaaagaggtggaagtagagcccaaaagacttgatgaagagattgactttataata
aataatttaaacaattatttaaatattaaaatagaaaaatcagatgtaaaaagcgtatat
actggaataagacccttaataatggatccaaaagccgaaggcaacacttcaaaaatttca
agaaacgaaaaaatatttatatcagattcaaatcttattacaatagcgggaggcaaatat
actacatatagaaaaatggcagaaaaaaccttgctcaaagccatagaaaaaaatttatta
ccaaattatccaccaactacagaagatttaaagttacacggctatcttaaaaaagaagca
gcagtaaaaattcctgaaccttttagaacttatggtagtgactttgaaattctaaaaaat
atggaagggtttgacaaaaagatacacgagagcttggatttaaatgaagctcaaatagcc
ttttcgattgaatttgagcaagccaaaactattgacgatgttttagcaagaagaacaaga
tcgttgcctttaaatccccaagctgcaattgaagctgccccaagggttgctgaaataatg
atgaaaaaattaaataaatctgaaaagtggaaaaatgaacaaataaaaacctttttagaa
ataagcaaaaaatatttaattaaaaattaa

DBGET integrated database retrieval system