KEGG   Burkholderia glumae LMG 2196 = ATCC 33617: KS03_1004Help
Entry
KS03_1004         CDS       T03820                                 

Gene name
acoD
Definition
(GenBank) acetaldehyde dehydrogenase 2
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
bgu  Burkholderia glumae LMG 2196 = ATCC 33617
Pathway
bgu00010  Glycolysis / Gluconeogenesis
bgu00620  Pyruvate metabolism
bgu01100  Metabolic pathways
bgu01110  Biosynthesis of secondary metabolites
bgu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bgu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KS03_1004 (acoD)
   00620 Pyruvate metabolism
    KS03_1004 (acoD)
Enzymes [BR:bgu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     KS03_1004 (acoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AJY67794
LinkDB All DBs
Position
I:complement(1107110..1108630)
Genome map
AA seq 506 aa AA seqDB search
MNHAEMQHLNIEFPYRKQYGNFIGGKWVPPVGGDYFDNVSPVTGKPFTSIPRSQAADIEL
ALDAAHAARAAWGATPAADRAGILLKIADRMEANLARLAVAETIDNGKPLRETTAADIPL
AIDHFRYFAGCVRAQEGSIADIGGDLVAYHFHEPLGVVGQIIPWNFPILMATWKLAPALA
AGNCVVLKPAEQTPASILVWAELIQDLLPPGVLNIVNGFGLEAGKPLASSKRIAKVAFTG
ETSTGRLIAGYASANLIPVTLELGGKSPNIFFADVMDRDDSYFDKALEGFAMFALNQGEV
CTCPSRALVEESIYERFIERAVQRVEKIRQGHPLDAQTMIGAQASEEQMEKILSYIEIGR
QEGAECLTGGARNTMTGELASGFYVKPTVFRGHNKMRIFQEEIFGPVLSVTTFKNEAEAL
EIANDTPYGLGAGLWTRDGNRAYHFGRNIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRET
HKMMLDHYQQTKNLLVSYSDKPAGLF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacgccgagatgcaacacctgaacatcgaattcccgtaccgcaagcagtacggg
aatttcatcgggggcaaatgggtgccgccggtcggcggcgactatttcgacaacgtctcg
cccgtcacgggcaagccgttcacgtcgatcccgcgctcgcaggcagccgacatcgagctc
gcgctcgacgcggcgcacgcggcgcgcgccgcctggggcgcgaccccggcggccgaccgc
gcgggcatcctgctcaagatcgccgaccgcatggaggcgaacctggcacgcctcgcggtg
gccgagacgatcgacaacggcaagccgctgcgcgagaccaccgcggccgacatcccgctc
gccatcgaccatttccgctatttcgcgggctgcgtgcgcgcgcaggaaggttcgatcgcc
gacatcggcggcgacctggtggcctaccacttccatgagccgctcggcgtggtcggccag
atcattccgtggaacttcccgatcctgatggccacctggaagctcgctccggcgctcgcg
gccggcaactgcgtggtgctgaagccggccgagcagaccccggcctcgatcctggtgtgg
gccgagctgatccaggacctgctgccgcccggcgtgctcaacatcgtcaacggcttcggg
ctcgaggccggcaagccgctcgcctccagcaagcggatcgccaaggtcgcgttcaccggc
gagacctccaccggccgcctgatcgccggctacgcgagcgcgaacctgatcccggtcacg
ctcgaactcggcggcaagagcccgaacatcttcttcgccgacgtgatggaccgcgacgac
agctacttcgacaaggcgctcgagggctttgcgatgttcgcgctgaaccagggcgaggtc
tgcacctgcccgtcgcgcgcgctggtcgaggaaagcatctacgagcgcttcatcgagcgc
gccgtgcagcgcgtcgaaaagatccgccagggccatccgctcgacgcgcagaccatgatc
ggcgcgcaggcctccgaggagcagatggagaagatcctgtcgtacatcgagatcggccgc
caggaaggcgccgaatgcctgacgggcggcgcgcgcaacaccatgacgggcgaactggcg
agcggcttctacgtgaagccgaccgtgttccgcggccacaacaagatgcgcatcttccag
gaggagatcttcgggccggtgctgtcggtgaccaccttcaagaacgaggccgaggcgctc
gagatcgccaacgacacgccctacggcctgggcgccggcctctggacccgcgacggcaac
cgcgcctatcacttcggccgcaacatccaggccgggcgcgtctggaccaactgctaccac
gcctatccggcgcacgcggcgttcggcggctacaagcagtccggcatcggccgcgagacg
cacaagatgatgctcgaccactaccagcagaccaagaacctgctggtcagctatagcgac
aagccggccggcctgttctga

DBGET integrated database retrieval system