KEGG   Burkholderia glumae LMG 2196 = ATCC 33617: KS03_12Help
Entry
KS03_12           CDS       T03820                                 

Definition
(GenBank) putative gst-related protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bgu  Burkholderia glumae LMG 2196 = ATCC 33617
Pathway
bgu00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bgu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    KS03_12
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bgu02000]
    KS03_12
Enzymes [BR:bgu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     KS03_12
Transporters [BR:bgu02000]
 Other Transporters
  Pores ion channels [TC:1]
   KS03_12
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_C_2 GST_N GST_N_2 GST_N_4 Tom37 GST_C DUF2406
Motif
Other DBs
NCBI-ProteinID: AJY67004
LinkDB All DBs
Position
I:complement(11327..11980)
Genome map
AA seq 217 aa AA seqDB search
MLQLCGYPLSNYYNKVKLVLLEYEIPFEEQPLPLPLRDSDALAASPFGKVPFLRTEHGAL
SESQAIVEYLAARYPDKALFPADPFEAAKVREVTIFIELYLEWVARDLYGQAFFGGTASD
ETRERVERQLVSALAAFRRLSRFEPFLLGDTYGIADVAAYIHLPLVGLATKAVYGRDLVL
EAGIDWKAYSKRVGERPAAQRVTADRKAHIEANGVKR
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaactctgtggttatccgctatcgaactactacaacaaggtgaaactcgtgctg
ctcgaatacgagattcctttcgaggagcaacctttgccgttgccgctgcgcgattccgat
gcgctggccgcttcgccgttcggtaaggtgccgttcctgcgcaccgagcatggcgcgctc
tcggagtcgcaggcgatcgtcgagtatctggccgcgcgttatccggacaaggcgctgttt
ccggccgatccgttcgaggcggccaaggtgcgcgaagtcacgatcttcatcgaactctat
ctcgaatgggtggcgcgtgacctgtacgggcaggcattttttggcggcacggccagcgac
gagacgcgcgagcgcgtcgagcggcaactggtgagcgcgctggccgcgtttcgccggctc
agccgcttcgagccattcttgctcggcgacacctacggcatcgccgatgtggccgcctat
atccacctgccgctcgtcgggctcgcgacgaaggctgtctacggccgcgatctggtgctc
gaagccgggatcgactggaaggcgtattcgaagcgcgtgggcgagcggcccgccgcgcag
cgcgtgacggccgaccgcaaggcgcacatcgaggccaacggcgtgaagcgctga

DBGET integrated database retrieval system