KEGG   Burkholderia glumae LMG 2196 = ATCC 33617: KS03_1784Help
Entry
KS03_1784         CDS       T03820                                 

Definition
(GenBank) amidase family protein
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
bgu  Burkholderia glumae LMG 2196 = ATCC 33617
Pathway
bgu00970  Aminoacyl-tRNA biosynthesis
bgu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    KS03_1784
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bgu03029]
    KS03_1784
Enzymes [BR:bgu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     KS03_1784
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     KS03_1784
Mitochondrial biogenesis [BR:bgu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    KS03_1784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AJY66924
LinkDB All DBs
Position
I:complement(1941596..1942972)
Genome map
AA seq 458 aa AA seqDB search
MTAFAPFPPLATLAADLAAGRTTSRALVDAALDRIAAPDGQGAVAFTAVDADAARATADA
HDRLRAAGTVLSPLAGIPVSVKDLFDIAGQVTRAGSRALADAPPAAADAPAVARLRRAGA
VLVGRTNMSEFAFSGLGLNPHYGTPRSPYRRAVAGDARVAGGSSSGAAVSVADGMAAAAL
GTDTGGSLRIPAALCGLTGFKPTASRVPKDGGVPLSSTLDSFGPIGVSVACCALVDRILA
GLAPRVPAMRPLEGVRLGVLDHYVTDGMDAEVTAAFSAALERLAAAGAILSDLRFAPLER
LDDINRFGFSPIEAYAWHRPLLERRRDTYDPRVLARIMKGQPATAADYLDLLAARAAMLD
EAERTLWPSVDAVLAPTVPVVPPRLAELERDDDAFARTNALILRNPSAFNFLDACALSVP
CHQRDGAPVGLMIAAAPHRDDTLLAIGQSIEAVLATSR
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctttcgcccccttccccccgctcgccacgctggccgccgatctcgcggccggc
cgcacgaccagccgcgcgctcgtcgacgccgcgctcgaccgcatcgcggcgcccgacggc
cagggtgcggtcgcgttcaccgccgtcgacgccgacgcggcccgcgcgacggccgacgcg
cacgaccgcctgcgcgcggccggcacggtgctgtcgccgctggccggcatcccggtgtcg
gtcaaggacctgttcgacatcgccggccaggtcacgcgggccggctcgcgcgcgctcgcc
gacgcgccgccggcggcggccgacgcgccggcggtggcacggctgcgccgggccggcgcg
gtgctggtcgggcgcaccaacatgagcgaattcgcgttctccgggctcggcctgaacccg
cactacggcacgccgcgctcgccttaccggcgcgcggtggcgggcgacgcgcgcgtggcc
ggcggctcatcgtcgggtgccgccgtttcggtggccgacggcatggcggccgccgcactc
ggcaccgacaccggcggctcgctgcggattccggccgcgctgtgcgggctgaccggcttc
aagccgactgcgagccgggtgccgaaggacggcggcgtaccgctatcgtcgacgctcgac
tcgttcggcccgatcggcgtgtcggtggcctgctgcgcgctggtggaccggattctggcc
gggctcgcgccgcgcgtgccggccatgcggccgctcgaaggcgtgcggctcggcgtgctc
gatcactatgtgacggacggcatggacgccgaggtgacggcggcgttcagcgccgcgctc
gaacgtctggcggcggccggcgcaatcctgtccgacctgcgcttcgccccgctcgagcgg
ctcgacgatatcaaccgcttcggcttctcgccgatcgaggcctacgcctggcaccggccc
ttgctcgagcgccgccgcgacacctacgatccgcgcgtgctggcgcgcatcatgaagggc
cagcccgccacggctgccgattatctcgatctgctcgccgcccgcgcggccatgctcgac
gaggccgagcgcacgctctggccgagcgtggacgcggtgctcgcgccgaccgtgccggtg
gtgccgccgcgcctggccgaactcgaacgcgacgacgacgcgttcgcgcgcaccaacgcg
ctgatcctgcgcaatccgagcgcgttcaacttcctcgacgcctgcgcgctgtcggtacca
tgccatcagcgcgacggcgcaccggtcggcctgatgatcgcggccgcgccccatcgcgac
gacacgctgctcgccatcggccagtcgatcgaggcggtgctcgcgacgagccgctga

DBGET integrated database retrieval system