KEGG   Burkholderia glumae LMG 2196 = ATCC 33617: KS03_2379Help
Entry
KS03_2379         CDS       T03820                                 

Definition
(GenBank) small Multidrug Resistance family protein
Organism
bgu  Burkholderia glumae LMG 2196 = ATCC 33617
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Multi_Drug_Res EamA TMEM234
Motif
Other DBs
NCBI-ProteinID: AJY66848
LinkDB All DBs
Position
I:complement(2602562..2602933)
Genome map
AA seq 123 aa AA seqDB search
MNPVSLVCIVTGVLLNACAQLLLKAGVNAVGHFEFTRANIIPVGFKIATQLPIIGGLGCY
VLSVVVWIVGLSRVDVSIAYPMLSLGYVVNAFAAWYLFGEVLSVQRLIGIGIILVGVLVL
ARS
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgaatcccgtttccctcgtctgcatcgtcaccggcgtgctgctgaacgcctgcgcgcaa
ctgctgctgaaggccggcgtcaacgccgtcggccatttcgagttcacgcgcgccaacatc
atcccggtcggcttcaagatcgcgacccagctgccgatcatcggcgggctcggctgctac
gtgctgagcgtggtggtctggatcgtcgggctgtcgcgcgtggacgtctcgatcgcctat
ccgatgctctcgctcggctatgtggtgaacgcgttcgccgcctggtatctgttcggcgag
gtgctgtcggtgcagcgcctgatcggcatcggcatcatcctggtgggggtgctggtgctg
gcgcgcagttga

DBGET integrated database retrieval system