KEGG   Burkholderia glumae LMG 2196 = ATCC 33617: KS03_3186Help
Entry
KS03_3186         CDS       T03820                                 

Gene name
cysE
Definition
(GenBank) serine O-acetyltransferase
  KO
K00640  serine O-acetyltransferase [EC:2.3.1.30]
Organism
bgu  Burkholderia glumae LMG 2196 = ATCC 33617
Pathway
bgu00270  Cysteine and methionine metabolism
bgu00920  Sulfur metabolism
bgu01100  Metabolic pathways
bgu01110  Biosynthesis of secondary metabolites
bgu01120  Microbial metabolism in diverse environments
bgu01200  Carbon metabolism
bgu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bgu00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    KS03_3186 (cysE)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    KS03_3186 (cysE)
Enzymes [BR:bgu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.30  serine O-acetyltransferase
     KS03_3186 (cysE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep SATase_N Hexapep_2
Motif
Other DBs
NCBI-ProteinID: AJY66312
LinkDB All DBs
Position
I:complement(3487371..3488135)
Genome map
AA seq 254 aa AA seqDB search
MFTRLREDIATIRERDPAARSAWEVLSCYPGIHALIFHRVAHACWRRDWRWLGRFISQAG
RFMTGIEIHPGATLGRRVFIDHGMGVVIGETAVVGDDCTIYQGVTLGGTSLTRGAKRHPT
LGRGVIVGAGAKVLGGFTVGEGAKIGSNAVVVRPVPAGGTAVGNPARVVLPAESKPAPAR
AEFSAYGITSNADDPMSLAIHGLVDHAARQAQRVDEIVAALERLGARFEALQADGRVDLQ
RLSAALEASVGEPR
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgttcacgagactccgagaagacatcgcgacgattcgcgagcgcgaccccgctgctcgc
agcgcctgggaagtgctgagctgttaccccggcatccacgcgctgattttccaccgcgtc
gcgcatgcgtgctggcggcgcgattggcgctggctcgggcgtttcatttcgcaggccggg
cgcttcatgaccggcatcgagatccatcctggcgccacgctcgggcgacgcgtgttcatc
gaccacggcatgggcgtggtgatcggcgagacggcggtcgtcggtgacgactgcacgatc
taccagggcgtgacgctcggcggcacctcgctcacgcgcggcgcgaagcgccatcccacg
ctcgggcgcggcgtgatcgtcggcgcgggggccaaggtgctcggcggcttcacggtgggc
gagggcgccaagatcggctcgaacgcggtggtcgtcaggccggtgccggcgggcggcacg
gcggtcggcaatcccgcccgcgtggtgctgccggccgagtcgaagccggcgccggcccgg
gccgagttcagcgcctacggcatcacctcgaacgccgacgacccgatgtcgctggcgatc
catggcctggtcgatcacgccgcccggcaagcgcagcgcgtcgacgagatcgtcgctgcg
ctggagcggctgggcgcgcgcttcgaggctctgcaggccgacggccgggtcgatctgcag
cggctgtccgctgctctcgaggcgagcgtgggcgagccgcgctga

DBGET integrated database retrieval system