KEGG   Burkholderia glumae LMG 2196 = ATCC 33617: KS03_3500
Entry
KS03_3500         CDS       T03820                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
bgu  Burkholderia glumae LMG 2196 = ATCC 33617
Brite
KEGG Orthology (KO) [BR:bgu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bgu02044]
    KS03_3500
Secretion system [BR:bgu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   KS03_3500
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: AJY63417
LinkDB
Position
II:complement(215971..216504)
AA seq 177 aa
MSVSNNSQKFIARNRAPRVQIEYDVEIYGSEKKVELPFVMGVLADLSGKPIEALPAVAER
KFFNIDIDNFDERMKAMKPRVAFSVPNTLTNQGELMVDMTFESMDDFSPAAVARKVDALA
QLLDARTQLANLQTYMDGKAGAESLVSKVLRDPALLEALAKAPKPRSASSDDATAGE
NT seq 534 nt   +upstreamnt  +downstreamnt
atgtccgtttccaacaattctcagaaattcattgcgcgtaatcgcgcgccgcgcgtgcag
atcgaatacgacgtggaaatctacggctcggaaaagaaggtcgagttgccgttcgtgatg
ggcgtgctggccgatctgtcaggcaaaccgatcgaggcgttgccggccgtagccgaacgc
aagttcttcaatatcgacatcgacaatttcgacgaacgcatgaaggcgatgaagccgcgc
gtcgcgttctcggtgccgaacacgctgacgaatcagggagagttgatggtcgacatgacc
ttcgagagcatggacgatttctcgcccgctgccgtggcgaggaaggtcgacgcgctcgcg
caactgctcgacgcacgcacacagctcgccaacctgcaaacctacatggacggcaaggcc
ggggccgaaagtctcgtcagcaaagtattgcgtgatcccgccttgctcgaagcactcgcc
aaggcgcccaagccgcggtccgcatcctccgacgacgcaacggccggtgagtga

DBGET integrated database retrieval system