KEGG   Burkholderia glumae LMG 2196 = ATCC 33617: KS03_3682Help
Entry
KS03_3682         CDS       T03820                                 

Definition
(GenBank) penicillin binding transpeptidase domain protein
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
bgu  Burkholderia glumae LMG 2196 = ATCC 33617
Pathway
bgu00550  Peptidoglycan biosynthesis
bgu01100  Metabolic pathways
bgu01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:bgu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    KS03_3682
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    KS03_3682
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bgu01003]
    KS03_3682
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bgu01011]
    KS03_3682
Enzymes [BR:bgu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     KS03_3682
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     KS03_3682
Glycosyltransferases [BR:bgu01003]
 Polysaccharide
  Bacterial polysaccharide
   KS03_3682
Peptidoglycan biosynthesis and degradation proteins [BR:bgu01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   KS03_3682
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: AJY63962
LinkDB All DBs
Position
II:426774..429416
Genome map
AA seq 880 aa AA seqDB search
MNRRFVSRLLARAAAWRAAVQPVVAAAVARARPRAAHVLAALWARLRHPTRRGVLIALAV
PPALLVLYVLVLIPFTPSIGDIRKARVDAPAQVMSADGRLLAEFKPSNREWVALADISPH
MVDALIATEDHRFYQHHGLDWRRTAGAALHTFSGDRQGGSTITQQLARNLYPDQIGRAPT
LTRKLKEAITALKIEAVYNKQQILETYLNTVPFLYNAYGVEMAARTYFDKSADQLDVLDS
ATLVGMLKGNSYYNPVINPERALQRRNTVLGQMVKYGKLSPAQFAVLQRKPLRIDFERQK
EPPGPAPHFAQQLKKWLIGWADRNDYNIYSDGLVVRTTIDSRLQAMATQALKLQANQLQA
IANGAWNAGSGCAPGNALFKTFMRESREYKAARDGGADDGTALKTLGRDRAFLRGLCKAK
ADLQAGFVAIDPRDGAIRAWVGSRDFATEPFDHVQQARRQPGSTFKPFVYGAAFADGAKP
TDTFIDQPVEIPLKGGEIWRPDDAEPPTGKPMTLADALAYSRNRITAQLMQQVGPAKVAR
LAREMGVRDSTLEAVPSLALGTSPVTLKEMVSGYATIANLGSYVEPRMVTRIEDRAGRVL
AEFAPAPPERALAPGAARTLVATLRGVINRGTGTAIRSRFGIRADVAGKTGTTQGDTDGW
FILIQPQLVAGAWVGFDDGRVTLGDTWGQGARSALPMVGDFYQRAFRARLIDARAKFDTD
TPPGFFDTLRGKLDDWIAYLFPARSAPPAAPAAPRGPALAPAPAPAPDAAQQAASAASAA
SAASAASAAAQAEAASDPLGAFLSGASGAAGTAGARRALPASGVDTFSASAPPLLPTAPV
NDGQGGNQGGTGNGLPAEAPAESPTPTPDSPSAGAGGTVQ
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcgtcgtttcgtgtcccgtctgcttgcccgtgccgccgcgtggcgggccgccgtc
cagcccgtcgtggccgccgccgtcgcccgcgcgcggccgcgcgcggcgcatgtgcttgcc
gcgctgtgggcccggctgcggcacccgacgcgccgcggcgtgctgatcgcgctggccgtg
ccgccggcgctgctggtgctctacgtgctggtgctgatcccgttcacgccgagcatcggc
gacatccgcaaggcgcgcgtggacgcgccggcccaggtgatgtcggccgacggcaggctg
ctcgccgagttcaagccgtccaaccgcgaatgggtcgcgctggccgacatctcgccgcac
atggtggacgcgctgatcgccaccgaggaccaccgcttctaccagcaccacggcctcgac
tggcgccgcaccgccggcgccgcgctgcacaccttctcgggcgaccggcagggcggctcc
accatcacccagcagctcgctcgcaacctctatcccgaccagatcggccgcgcgcccacg
ctcacgcgcaagctcaaggaagcgatcacggcgctgaagatcgaggccgtctacaacaag
cagcagatcctcgagacctacctgaacacggtcccgttcctctacaacgcctacggcgtg
gagatggccgcgcgcacctacttcgacaagtcggccgaccagctcgacgtgctcgacagc
gccacgctggtgggcatgctcaagggcaacagctactacaacccggtgatcaaccccgag
cgcgcgctgcagcggcgcaacaccgtgctcgggcagatggtgaagtacggcaagctctcg
cccgcgcagttcgcggtgctgcaaaggaagccgctgcgcatcgacttcgagcgccagaag
gagccgcccggcccggcgccgcatttcgcgcagcagctgaagaaatggctgatcggctgg
gccgaccgcaacgactacaacatctattccgacggcctcgtcgtgcgcaccacgatcgat
tcgcggctgcaggcgatggccacccaggcgctcaagctgcaggccaaccagctgcaggcc
atcgccaacggcgcctggaacgccggcagcggctgcgcgcccggcaacgcgctgttcaag
accttcatgcgcgagtcgcgcgaatacaaggccgcgcgcgacggcggcgccgacgacggc
acggcgctcaagacgctcggccgcgatcgcgccttcctgcgcgggctctgcaaggccaag
gcggacctgcaggccggcttcgtcgcgatcgacccgcgcgacggcgcgatccgcgcctgg
gtgggcagccgcgacttcgccaccgagccgttcgaccacgtgcagcaggcgcgccgccag
ccgggctcgaccttcaagccgttcgtctacggcgccgcgttcgccgacggcgcgaagccc
accgacaccttcatcgaccagccggtcgagattccgctcaagggcggcgagatctggcgc
ccggacgacgccgagccgcccaccggcaagccgatgacgctggccgacgcgctcgcctac
tcgcgcaaccgcatcaccgcgcagctgatgcagcaggtcgggccggccaaggtcgcgcga
ctcgcgcgcgagatgggcgtgcgcgacagcacgctggaggcggtgccctcgctcgcgctc
ggcaccagcccggtcacgctcaaggagatggtgtcgggctacgcgaccatcgccaacctc
ggcagctacgtcgaaccgcgcatggtcacgcgcatcgaggatcgcgccggccgtgtgctg
gccgaattcgcgccggcgccgcccgagcgcgcgctcgcgcccggcgcggcgcgcacgctg
gtggcgaccctgcgcggcgtgatcaatcgcggcaccggcacggcgatccgctcgcgcttc
gggattcgcgccgacgtggccggcaagaccggcaccacgcagggcgacaccgacggctgg
ttcatcctgatccagccgcaactggtggcgggcgcctgggtgggcttcgacgacgggcgc
gtgacgctcggcgacacctgggggcagggcgcgcgcagcgcgctgccgatggtcggtgac
ttctaccagcgcgcgttccgggccaggttgatcgatgcgcgcgcgaagttcgacaccgac
acgccgccgggcttcttcgacacgctgcgcggcaagctcgacgactggatcgcctatctg
ttcccggcccggtccgcgccaccggccgcgccggccgcgccgcgcggaccggcgctggcg
cccgcgcccgcgccggcaccggacgcggcgcagcaggcggccagcgccgcgagcgcggcc
agtgcggcgagcgcggcgagcgcggcggcgcaggccgaggcggcgtccgatccgctcggc
gcgttcctgagcggcgcatccggcgcggcgggaacggccggcgcgcggcgggcgctcccg
gcatcgggcgtcgataccttcagcgcgtcggcaccgccgctgctgccgacggcgccggtg
aacgacggccagggcggcaaccagggcggcacgggcaacggcctgccggccgaggcgccg
gccgagtcgccgacgccgacgcccgactcgccctccgcgggcgccggcggcaccgtccaa
tag

DBGET integrated database retrieval system