KEGG   Burkholderia glumae LMG 2196 = ATCC 33617: KS03_4298Help
Entry
KS03_4298         CDS       T03820                                 

Definition
(GenBank) FKBP-type peptidyl-prolyl cis-trans isomerase family protein
  KO
K03772  FKBP-type peptidyl-prolyl cis-trans isomerase FkpA [EC:5.2.1.8]
Organism
bgu  Burkholderia glumae LMG 2196 = ATCC 33617
Brite
KEGG Orthology (KO) [BR:bgu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bgu03110]
    KS03_4298
Enzymes [BR:bgu01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     KS03_4298
Chaperones and folding catalysts [BR:bgu03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    KS03_4298
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FKBP_C
Motif
Other DBs
NCBI-ProteinID: AJY63693
LinkDB All DBs
Position
II:complement(1138547..1138888)
Genome map
AA seq 113 aa AA seqDB search
MTVVTTDSGLKYEELTEGTGAEAKAGQSVTVHYTGWLTDGQKFDSSKDRNDPFVFVLGGG
MVIKGWDEGVQGMKVGGTRRLTIPASLGYGARGAGGVIPPNATLVFEVELLAV
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcgtcaccaccgattcgggcctcaagtacgaagaactgaccgaaggtacgggc
gccgaagccaaggccggccagtccgtcaccgtccactacacgggctggctgaccgacggc
cagaagttcgattcgagcaaggatcgcaacgacccgttcgtgttcgtgctgggcggcggc
atggtgatcaagggctgggacgaaggggtccagggcatgaaggtgggcggcacgcgccgc
ctgacgatcccggcctcgctcggctacggcgcgcgcggcgcgggcggcgtgattccgccg
aacgccacgctggtgttcgaggtcgagctgctggccgtctga

DBGET integrated database retrieval system