KEGG   Burkholderia glumae LMG 2196 = ATCC 33617: KS03_4595Help
Entry
KS03_4595         CDS       T03820                                 

Gene name
aepX
Definition
(GenBank) phosphoenolpyruvate mutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bgu  Burkholderia glumae LMG 2196 = ATCC 33617
Pathway
bgu00440  Phosphonate and phosphinate metabolism
bgu01100  Metabolic pathways
bgu01120  Microbial metabolism in diverse environments
bgu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bgu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    KS03_4595 (aepX)
Enzymes [BR:bgu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     KS03_4595 (aepX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL PEP_hydrolase IspD Ribul_P_3_epim
Motif
Other DBs
NCBI-ProteinID: AJY62974
LinkDB All DBs
Position
II:complement(1475786..1477471)
Genome map
AA seq 561 aa AA seqDB search
MNAREPNFTESRAARLRRMLTSHELEFLMEAHNGLSAKIVREAGFKAIWGSGLSISAALG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNMRRLVRKLEQRGIAGVCIED
KQFPKTNSFIDGERQPLAEIDEFAGKIKAGKDSQHDPDFSIVARVEALIAGWGMDEALRR
AHAYADAGADAILIHSKLSRPDEILQFAREWGNRAPLVIVPTKYYSTPTDVFRQAGISTV
IWANHLVRSSAAAMQATAREIFESETLVNVEDRVATVNEIFRLQDADEYSAAERLYLSSS
SRASNSALVLAASRGSGLEAVTEDKPKVMLPIAGKPLLRWLVDGFKKEGVNDITVVGGYR
ADAIDKSGVKLVVNERHAETGELASLACAVDRINGDTVISYGDLLFRSYILRDLAESDAE
FTVVVDSSLTDSPNQSVRDFALCSAADDRGLFGQKITLQRVASDAGNGAPHGRWIGLLNV
RGAGVERLKATIATLQSRPDFDQLDIPALLNALVEAGEQIAVQYVHGHWRGVNDLDEFRR
AGDFAHGQTPLASGTADGDAQ
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcacgcgaacccaatttcaccgaatcccgcgccgcgcggctgcggcgcatgctg
acgagccacgagctcgaattcctgatggaagcgcacaacggcctgtccgcgaagatcgtg
cgcgaggccggcttcaaggcgatctggggctcgggcctgtcgatctccgccgcgctcggc
gtgcgcgacaacaacgaggcgagctggacccaggtggtggacgtgctcgaattcatggcc
gacgcgagcgatctgccgatcctgctcgacggcgacaccggctacggcaacttcaacaac
atgcgccgcctggtgcgcaagctcgagcagcgcggcatcgccggcgtctgcatcgaggac
aagcagttcccgaagaccaacagcttcatcgacggcgaacgccagccgctcgccgagatc
gacgagttcgcgggcaagatcaaggccggcaaggattcgcagcacgatccggacttctcg
atcgtggcgcgcgtcgaggcgctgatcgcgggctggggcatggacgaggcgctgcgccgc
gcgcatgcctacgccgacgccggcgccgacgcgatcctgatccacagcaagctgtcgcgc
ccggacgagatcctccagttcgcgcgcgagtggggcaaccgcgcgccgctcgtgatcgtg
ccgaccaagtactacagcacgcccaccgacgtgttccgccaggccggcatcagcaccgtg
atctgggccaaccacctggtgcgctcgtcggccgccgcgatgcaggccaccgcgcgcgag
atcttcgagagcgagacgctcgtcaacgtcgaggatcgcgtggccaccgtcaacgagatc
ttccgcctgcaggacgccgacgaatactcggccgccgagcgcctctacctgtcgtcgtcg
tcgcgcgcgtcgaactcggcgctggtgctcgcggcgagccgcggctcgggcctcgaggcc
gtcaccgaggacaagccgaaggtgatgctgccgatcgccggcaagccgctgctgcgctgg
ctggtggacggcttcaagaaggaaggcgtaaacgacatcacggtggtgggcggctaccgc
gccgacgcgatcgacaagtcgggcgtgaagctggtggtcaacgagcgccatgccgaaacg
ggcgagctcgcctcgctggcctgcgcggtcgaccggatcaacggcgacaccgtgatttcc
tacggcgacctgctgttccgcagctacatcctgcgcgacctggccgagagcgacgccgag
ttcacggtggtggtggattcgtcgctgaccgattcgccgaaccagagcgtgcgcgacttc
gcgctgtgctcggccgccgacgaccgcggcctgttcggccagaagatcacgctgcagcgc
gtggcgagcgacgccggcaacggcgcgccgcacggccgctggatcggcctcctgaacgtg
cgcggcgcgggcgtggagcgcctgaaggcgacgatcgcgacgctgcagtcacgccccgac
ttcgaccagctcgacattccggcgctgctcaacgcgctggtggaggccggcgagcagatc
gcggtgcaatacgtgcacggccactggcgcggcgtgaacgacctcgacgaattccgccgc
gcaggcgacttcgcgcacggccagacgccgctcgcgagcggcacggccgacggggacgcg
caatga

DBGET integrated database retrieval system