KEGG   Burkholderia glumae LMG 2196 = ATCC 33617: KS03_4630Help
Entry
KS03_4630         CDS       T03820                                 

Definition
(GenBank) D-ala D-ala ligase family protein
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
bgu  Burkholderia glumae LMG 2196 = ATCC 33617
Pathway
bgu00061  Fatty acid biosynthesis
bgu00620  Pyruvate metabolism
bgu00640  Propanoate metabolism
bgu01100  Metabolic pathways
bgu01110  Biosynthesis of secondary metabolites
bgu01120  Microbial metabolism in diverse environments
bgu01130  Biosynthesis of antibiotics
bgu01200  Carbon metabolism
bgu01212  Fatty acid metabolism
Module
bgu_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bgu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    KS03_4630
   00640 Propanoate metabolism
    KS03_4630
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    KS03_4630
Enzymes [BR:bgu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     KS03_4630
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     KS03_4630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 CoA_binding_2 Oxidored_nitro DUF2163
Motif
Other DBs
NCBI-ProteinID: AJY62821
LinkDB All DBs
Position
II:complement(1517772..1519229)
Genome map
AA seq 485 aa AA seqDB search
MKPATSPDAFYRPSRITTVLVANRGEIAVRVIRAARELGMRAVAVVSDADRDSLAARMAD
EAIRIGASHAAKSYLNPAVILDAARQCGADAIHPGYGFLSENAAFAAQVEAAGLIFVGPD
SQVIATMGDKARARDTARRANVPTVPGSDGVVQSLDEARAVAGRIGYPIMIKAAAGGGGR
GIRVAHDAAQLDAELPLAQREAQAAFGDGGVYLERFIACARHIEVQVLGDGHDVVHLFER
ECSLQRRRQKILEEAPSPSLTPEQRDALCTSATRLAREVGYRSAGTLEYLFDDARGEFYF
IEMNTRIQVEHPVTEAITGIDLVRETLRIADGEPLRFEQTDIAIRGAALECRINAEDPLQ
DFRPNPGRIDALVWPTGPGVRIDSLLYPGYVVPPFYDSLLAKLIVHDESRGAALRRLARA
LGELHVGGLKTTAPLHVALLADDDVRAGRYHTNFLEAWMLRWREAATAAARQHETADAAR
VGEAL
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaagccggcaacctcccccgacgcgttctatcgtccgtcgcggatcacgaccgtgctg
gtcgcgaatcgcggcgagatcgcggtgcgcgtgatccgcgcggcgcgcgaactcggcatg
cgcgcggtcgccgtggtcagcgacgccgaccgcgacagcctcgccgcgcgcatggccgac
gaggcgatccgcatcggcgcatcgcatgccgcgaaaagctatctaaatcccgccgtgatc
ctcgacgctgcgcggcaatgcggtgcggacgcgatccatcccggctacggcttcctgtcc
gaaaatgccgcgttcgccgcgcaggtcgaggcggcagggctgatcttcgtcgggccggat
tcgcaggtcattgcgacgatgggcgacaaggcgcgcgcccgtgacaccgcgcggcgcgcg
aacgtgccaacggtgcccggcagcgacggcgtcgtgcagtcgctcgacgaggcccgcgca
gtcgccgggcgaatcggttatccaattatgatcaaggcggccgcgggcggcggcgggcgc
ggcattcgcgttgcgcacgacgccgcacagctcgacgccgagctgccgctcgcgcagcgc
gaggcgcaggccgcgttcggcgacggcggcgtctatctcgaacgcttcatcgcgtgcgcc
cggcacatcgaggtgcaggtgctcggcgacggccacgacgtcgtccatctgttcgagcgc
gaatgctcgctgcagcgacgccgccagaagattctcgaggaagcgccgtcgccgtcgctc
acgccggagcagcgcgacgctctgtgcacgtcggccacgcgcctcgcgcgcgaagtcggc
tatcgcagtgcgggcacgctcgaatacctgttcgacgacgcgcgcggcgaattctacttc
atcgagatgaacacgcgcatccaggttgagcatccagtaaccgaggcgatcaccggcatc
gacctcgtgcgcgagacgctgcgcatcgccgacggcgagccgctgcggttcgagcaaacg
gacatcgcgatacggggcgcggcgctcgaatgccggatcaatgcggaagatccgctgcag
gatttccgcccgaatccaggccggatcgacgcactcgtatggccgaccggccccggcgta
cgcatcgattcgctgctctacccgggctacgtcgtgccgccgttctacgattcgctgctc
gcgaagctaatcgtgcacgacgagagccgcggggccgcgctgcggcgtctcgctcgcgcg
ctcggcgagttgcacgtcggcggcctgaagaccaccgcgccgctgcacgtcgcgctgctc
gcggacgacgacgtccgcgcgggccgttatcacacgaattttctcgaagcttggatgctg
cgatggcgcgaggccgcaacggccgccgcccggcagcatgaaaccgcggacgccgcgcgc
gtcggggaggcactgtga

DBGET integrated database retrieval system