KEGG   Burkholderia glumae LMG 2196 = ATCC 33617: KS03_5115
Entry
KS03_5115         CDS       T03820                                 

Definition
(GenBank) AMP-binding enzyme family protein
  KO
K03397  indoleacetate---lysine synthetase [EC:6.3.2.20]
Organism
bgu  Burkholderia glumae LMG 2196 = ATCC 33617
Brite
KEGG Orthology (KO) [BR:bgu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    KS03_5115
Enzymes [BR:bgu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.20  indoleacetate---lysine synthetase
     KS03_5115
SSDB
Motif
Pfam: AMP-binding D-ser_dehydrat PSCyt2
Other DBs
NCBI-ProteinID: AJY63013
LinkDB
Position
II:complement(2232981..2234216)
AA seq 411 aa
MSDRTTRFDASTVSEALSYDARYAHELPTGVASYAAFRELVAIETADDLKRRVLDRLDHA
GLAGATFYTTSGTSGEVKLLLNAPSRKRPDTTYGRSLANALAGTAIAPTDRVANLFTAGG
FSTLYDGVNRLLEAIGANVLPIGRLDAYGADLPAMLDLIGRARPNVLVGTPTSVLQCLRL
LDAHGIDLDVAKILYTGEAFSERKRAIVRQRWRDAAFFGLYGTTETGFLGYHTPRCAQGH
YHVFDEWFFLEEEDGQLLVTSRANPGLAMLRYRIGDRVRIGPSVCCTCGEGGSVVVLQGR
ADQRFKFAGNLVSAELLAQRLAACAGRPLDCQFQLHADALGRDCLTVALDLDEDELAPLA
SRLAAALLEIEDLRECVDKGEGRLMVLGRDALRFSARQKLPRLIDERHAHV
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgtccgaccgcacgactcgcttcgatgcatccaccgtgagcgaagcgctttcgtacgat
gcccgctacgcgcatgagctgccgaccggcgtggccagctatgcggcgttccgcgagctg
gtggcgatcgagaccgccgacgacctgaagcggcgcgtgctggaccgtctcgatcacgcg
ggccttgccggcgcgacgttctacaccacgtcgggcacgagcggcgaggtcaagctgctg
ctcaacgcgccctcgcgcaagcggcccgacaccacctatggccgttcgctcgcgaatgcg
ctggcgggaaccgcgatcgcgccgaccgaccgcgtcgcgaacctgtttaccgccggcggc
ttttccacgctgtacgacggcgtgaaccgcctgctcgaagcgatcggcgcgaatgtcctg
ccgatcgggcggctcgacgcctacggcgccgatttgcccgcgatgctggaccttatcggc
cgcgcccgccccaacgttctggtcggcacgccgacgagcgtgctgcagtgccttcggctg
ctcgacgcgcacggcatcgatctcgatgtcgcgaagattctctacaccggcgaggcattc
tccgagcgcaagcgcgcgatcgtgcggcagcgctggcgcgatgccgccttcttcgggctg
tacggcaccaccgaaacgggcttcctcggctatcacacgccgcgctgcgcgcagggacat
taccacgtgttcgacgagtggtttttcctcgaggaggaagacgggcaactgctcgtgacc
agccgtgcgaatcctggcctcgcgatgctgcgctaccggatcggcgatcgcgtgcgcatc
gggccgtcggtgtgctgcacgtgcggcgagggcggctcggtggtcgtgctgcagggccgg
gcggatcagcgcttcaagttcgcgggcaacctggtcagcgccgaactgctcgcgcagcgg
ctggcggcgtgcgccggccggccgctcgattgtcagtttcagctgcatgccgacgcgctc
gggcgcgactgccttaccgtcgcgctggacctcgacgaggacgaactcgcgccgctcgcg
tcacggctggccgctgcgctgctcgagatcgaggatctgcgcgaatgcgtcgacaagggt
gaggggcgtctcatggtgctcggccgcgatgcattgcgcttttcggcgcgccagaagctg
ccgcgcctgatcgacgagaggcacgcccatgtctga

DBGET integrated database retrieval system