KEGG   Burkholderia glumae LMG 2196 = ATCC 33617: KS03_5428Help
Entry
KS03_5428         CDS       T03820                                 

Definition
(GenBank) hypothetical protein
  KO
K22130  3-dehydro-4-phosphotetronate decarboxylase [EC:4.1.1.104]
Organism
bgu  Burkholderia glumae LMG 2196 = ATCC 33617
Brite
KEGG Orthology (KO) [BR:bgu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    KS03_5428
Enzymes [BR:bgu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.104  3-dehydro-4-phosphotetronate decarboxylase
     KS03_5428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AJY64697
LinkDB All DBs
Position
II:2608724..2609362
Genome map
AA seq 212 aa AA seqDB search
MSTEQQLRETLCAVGASLFARGHAVGTAGNLSARLDDGWLITPTDACLGRLDPARIAKVD
LNGQPVSGDKPSKTLALHRGIYARNPEARGVVHTHSTHLVALTLAGVWRDEDVLPPITPY
YVMKVGHVPLIRYRRPGDPAVAAEVAALADRVRGVLLERLGPVVWAPSVEQASAVLEELE
ETARLWLMTNPKPAPLDEPALDELRRSFGARW
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgaacagcagctgcgcgaaaccctctgcgcagtgggcgcgagcctgttcgcg
cgcggccacgcggtaggcaccgccggcaacctcagcgcgcggctcgacgacggctggctg
atcacgcccaccgacgcatgcctgggccggctcgacccggcgcgcatcgccaaggtggac
ctgaacggccagcccgtgtccggcgacaagccctcgaagacgctcgcgctgcatcgcggc
atctacgcgcgcaatcccgaagcgcgcggcgtggtccacacgcactcgacccatctcgtc
gcgctgacgctcgcgggagtctggcgcgacgaggacgtgctgccgccgatcacgccgtat
tacgtgatgaaggtcggccatgtgccgctgatccgctaccggcgcccgggcgaccccgcc
gtcgcggccgaggtggccgcgctggccgaccgcgtgcgcggcgtgctgctcgaacggctc
gggccggtggtgtgggcgccgtcggtcgagcaggcctcggcggtgctcgaggagctggag
gaaaccgcgcggctgtggctgatgacgaacccgaagccggcgccgctcgacgagcccgcg
ctcgacgagctgcgccgcagcttcggcgcgcgctggtga

DBGET integrated database retrieval system