KEGG   Candidate division Kazan bacterium GW2011_GWA1_50_15: VE98_C0001G0160Help
Entry
VE98_C0001G0160   CDS       T03988                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bgw  Candidate division Kazan bacterium GW2011_GWA1_50_15
Brite
Enzymes [BR:bgw01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     VE98_C0001G0160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AKM84617
UniProt: A0A0G4BC33
LinkDB All DBs
Position
complement(150669..151235)
Genome map
AA seq 188 aa AA seqDB search
MYEAKDFSQSLELPGFSDNALNTHFKLYQGYVANTNKLADKLKTTAPDQPEYAELKRRFG
WEFNGMRLHEYYFGGLSKSPAALDPGSPLHQKITEDFGSYENWETDFKATAMIRGIGWAI
LYYDPTANRLFNIFVNEHDLGHLAGCVVLLNLDIFEHAFMLDYNTNRTDYITAFMNVIDW
STVAKRLQ
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaagctaaagatttctcgcaatcgttggagctacccgggttttcggataacgct
cttaacacccactttaagttgtatcagggctatgttgccaataccaataaattggccgac
aagttgaaaaccacagccccagaccagcccgagtacgctgaactcaaacggagattcggg
tgggagttcaatgggatgcgcctgcatgaatactatttcggtggtttaagtaaatcaccg
gctgcacttgacccaggttcgcccctgcaccaaaaaatcaccgaggatttcggttcctat
gaaaattgggagacagattttaaagccactgctatgatacgcggtattggttgggccatt
ctctactacgacccaacggccaaccgattgtttaatattttcgtcaacgaacacgatctc
ggccatctggctggctgcgtagtcctgctcaacctcgatatcttcgagcacgcctttatg
ctcgactacaacaccaaccgcaccgactatatcaccgcgttcatgaacgtcatcgactgg
tcaacggtcgcaaagcgcctgcagtag

DBGET integrated database retrieval system