KEGG   Bacillus glycinifermentans: BGLY_0079Help
Entry
BGLY_0079         CDS       T04537                                 

Gene name
hslO
Definition
(GenBank) 33 kDa chaperonin
  KO
K04083  molecular chaperone Hsp33
Organism
bgy  Bacillus glycinifermentans
Brite
KEGG Orthology (KO) [BR:bgy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bgy03110]
    BGLY_0079 (hslO)
Chaperones and folding catalysts [BR:bgy03110]
 Heat shock proteins
  HSP33
   BGLY_0079 (hslO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: SCA83902
UniProt: A0A1C3S7Q1
LinkDB All DBs
Position
1:87377..88246
Genome map
AA seq 289 aa AA seqDB search
MDYLVKAIAYDGKVRAYAARTTETIHEAQRRHNTWPTASAALGRTMTAAVMLGAMLKGED
KLTVKIEGGGPIGAIVADGNAKGEVRGYVSNPHVHFDLNEQGKLDVRRAVGTSGTLSVVK
DLGMRELFTGQVEIVSGELGEDFTYYLVSSEQVPSSVGVGVLVNPDNTILAAGGFIIQLL
PGTDDATITKLETNLSKVEPISKLIQKGLTPEAVLSAVLGEEPEVLETVPVRFACNCSKE
RFARGIIGLGKQEIQAMIDEDGKAEAQCHFCNETYLFTKEELEALLNEI
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggattatttagtaaaagccatagcatatgacggcaaagtccgcgcatatgcagcgaga
acgacagaaacgatacatgaagcgcaaaggcgccacaatacatggcctactgcctctgcc
gctttaggcagaacgatgacagcggccgtgatgctcggtgcgatgctgaaaggcgaagac
aagcttacggttaaaatcgaagggggcgggccgatcggggccattgtcgccgacgggaac
gcaaaaggtgaagtaaggggatatgtctcaaatccgcacgttcatttcgatttgaatgaa
caagggaagcttgacgtcagaagagcggtcggaacttccgggacattaagcgttgtgaaa
gatctcgggatgcgagagctgtttacgggtcaggttgagatcgtttccggagagctcggc
gaggattttacgtattatctcgtttcgtccgagcaagttccgtcatccgtaggtgtcggc
gttctcgtcaatccagacaatacgattttggcggccggcgggtttatcattcagctgcta
ccgggcactgatgatgcaaccattacaaagcttgaaaccaatttatctaaagtggagccg
atatctaagctgattcaaaagggccttacacctgaagcggtgcttagcgccgtcttggga
gaggagccggaagtgcttgagactgttcccgtccgctttgcgtgcaattgttcaaaagag
cgctttgcaagagggattatcggacttggcaaacaggagattcaggcgatgatcgatgaa
gacggcaaggccgaagcgcaatgccatttctgcaatgaaacgtatttgtttacaaaggaa
gagcttgaagcgcttctgaatgagatataa

DBGET integrated database retrieval system