KEGG   Bacillus glycinifermentans: BGLY_0571Help
Entry
BGLY_0571         CDS       T04537                                 

Gene name
alr
Definition
(GenBank) D-alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bgy  Bacillus glycinifermentans
Pathway
bgy00473  D-Alanine metabolism
bgy01100  Metabolic pathways
bgy01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bgy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BGLY_0571 (alr)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BGLY_0571 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bgy01011]
    BGLY_0571 (alr)
Enzymes [BR:bgy01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BGLY_0571 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:bgy01011]
 Precursor biosynthesis
  Racemase
   BGLY_0571 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: SCA84394
UniProt: A0A1C3S964
LinkDB All DBs
Position
1:604093..605253
Genome map
AA seq 386 aa AA seqDB search
MSLKPFYRKTWAEIDLTALKENVRNMKRHIGGDVDLMAVVKANAYGHGDAQVAKAALAEG
ASILAVAFLDEAISLREQGIDAPILVLGAVPPEYAGIAAKRRITVTGYSVSWLKEVLRLI
GDIGEPLDFHLKIDTGMGRLGCRNEDEIKEMMDMTESSSKVNCCGVFTHFATADEKDTDY
FNMQLDRFKELIKPLPLDRLMVHSSNSAAGMRFKKQLFNAVRFGVSMYGMSPSSEIKDEL
PFPLKEVFSLHTELVHVKKIAKGESVSYGATYTAEHDEWIGTVPVGYADGWLRRLAGSEV
LIDGKRQEIAGRICMDQFMISLQEEYPVGTKVTLIGKQKDETISVDEIAQKLQTINYEIT
CMISSRVPRMFLENGSIMEIRNPILP
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgagcttaaaaccattctatcgaaagacatgggcagaaatcgacttaacagccttaaag
gaaaatgtacggaatatgaagcgtcatatcggcggggatgttgacctgatggcggtcgtc
aaagcgaatgcctacgggcatggggacgcccaggtggcgaaggcggcccttgcagaaggt
gcatcaattctcgccgtggcctttttggatgaagcgatttcgttaagggaacaagggata
gacgcaccgattctcgtgctcggagcggtgccgccggaatatgccggcattgccgcaaaa
cggcgcattaccgtcaccggctattcggtcagctggctgaaagaagtgcttcgtttgatc
ggtgacatcggcgaaccgctcgattttcacttgaaaatcgacacaggcatgggacggctc
ggctgcagaaatgaagatgaaataaaagaaatgatggatatgactgaatcgtccagcaag
gtgaactgctgcggcgtcttcacccatttcgccacagcggacgaaaaggatacggattat
ttcaacatgcagcttgaccgctttaaggaactgatcaaaccgcttccgctcgaccggctg
atggtgcattcgtcaaacagcgccgccggcatgcggtttaagaagcagctctttaacgcg
gttcgtttcggcgtcagcatgtacggcatgtcgccgtcatccgagattaaagacgagctt
ccgtttccgttgaaggaagtgttttcgcttcatacagagctcgttcatgtgaaaaaaatc
gccaaaggcgagagcgtcagctacggtgcgacgtatacggccgaacatgatgagtggatc
gggaccgtccctgtcggctatgcggacggctggctccgccgccttgccggaagcgaagtg
ctgatcgacggaaaaaggcaggaaatcgccggcagaatctgcatggatcagtttatgatc
tcccttcaagaagaatatccggtcggcacaaaagtaaccttaatcggaaagcagaaagac
gaaacgatttcagtcgacgaaatcgcccaaaaactgcaaacgattaattatgaaattacc
tgcatgataagttcaagggtcccccgtatgtttttggaaaatgggagtataatggaaata
aggaatccgattttaccgtaa

DBGET integrated database retrieval system