KEGG   Bacillus glycinifermentans: BGLY_0685Help
Entry
BGLY_0685         CDS       T04537                                 

Gene name
amyS
Definition
(GenBank) Alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
bgy  Bacillus glycinifermentans
Pathway
bgy00500  Starch and sucrose metabolism
bgy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BGLY_0685 (amyS)
Enzymes [BR:bgy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BGLY_0685 (amyS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 DUF1939
Motif
Other DBs
NCBI-ProteinID: SCA84508
UniProt: A0A1C3S9X4
LinkDB All DBs
Position
1:715267..716796
Genome map
AA seq 509 aa AA seqDB search
MVFKRKLLCCVLLFFIMLPASKTDAASLNGTLMQYFEWNLPNDGQHWKRLQSDAGYLSDI
GITAVWIPPAYKGTSQSDVGYGPYDLYDLGEFDQKGTVRTKYGTKTELQSAIGSLHSESI
QVYGDVVLNHKAGADQAEDVTAVEVNQNNRNQETSGEHQIKAWTRFDFPGRGSTYSDFKW
RSHHFDGADWDESRKLNRIYKFQGKAWDWEVSSEHGNYDYLMYADVDYDHPDVAKEMKRW
GTWYANELQLDGFRLDAVKHIKFSFLRDWVDAVRLSTGKEMFTVAEYWQNHLGELENYLN
KTNFNHSVFDVPLHYHFHAASSQGGGYDMRHLLNGTVVSKHPLKAVTFVDNHDTQPGQSL
ESTVQTWFKPLAYAFILTREAGYPQVFYGDVYGTKGSTSREIPPLKGKIEPILKARKHYA
YGKQHDYFDHHDIVGWTREGDPSVGRSGLAALITDGPGGSKWMYAGRQNAGETWYDITGN
RSDSVTINSDGWGQFHVNGGSVSIYVQRP
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggttttcaagcgcaagctattatgctgcgtgctgctgtttttcattatgctgcctgca
tcgaaaacggatgcggcaagtctgaacggcaccctgatgcagtatttcgaatggaatctg
cctaatgacggacaacattggaaacgcttgcaaagcgatgcgggatatttatccgacatc
ggaataacggccgtatggattcctccggcctacaaggggactagccaatctgacgttgga
tacggcccgtacgatttgtacgatctgggagagtttgatcaaaaagggacggtgcggacg
aaatacgggacaaaaacggagctccagtcagcgatcggttcgcttcattccgagagcatc
caagtgtatggagatgttgtccttaaccacaaggcgggtgcagatcaagcggaggacgta
accgcagttgaagtgaaccagaacaatcggaatcaggaaacatccggagagcatcaaatc
aaagcgtggacacgattcgattttcccgggcgcggcagcacttacagcgattttaagtgg
cgctcgcaccatttcgacggagccgactgggatgagtccagaaagctgaaccgcatctat
aagtttcaagggaaagcctgggattgggaagtgtcgagcgaacacgggaactacgattat
ttgatgtatgcagatgttgactatgaccatcccgatgttgcgaaggaaatgaaacgatgg
ggaacctggtatgcaaacgagctgcagttggacgggtttcgccttgatgccgtcaaacat
attaaattttcgtttttgcgcgattgggtggatgctgtcaggctatcaacaggaaaggaa
atgttcacggtggccgagtattggcaaaatcaccttggcgaactcgaaaactacttgaat
aaaacaaactttaatcactccgtttttgatgtgccgctccactatcattttcatgccgca
tcttcgcaagggggcggctatgatatgaggcatttgctgaacggaacggtcgtttccaag
catcctttgaaagcggttacattcgttgacaatcatgatacacagccgggacaatcgctt
gagtctacggtacaaacgtggtttaagccgctcgcttatgcgttcattttgacaagggaa
gccggctacccgcaagttttctatggggatgtgtacgggacaaaaggctcgacatcgcgg
gaaattcccccgctcaaaggtaaaatagagccgatattaaaagcgcgcaaacactatgca
tacggaaaacagcacgattatttcgatcatcacgatatcgtcggctggacgagggaaggc
gatccatcggtcggacgatcaggtttggcggctttaatcacggatggtccgggcggatca
aagtggatgtatgcaggccggcaaaatgcgggagagacgtggtatgacatcaccgggaac
aggtcggattccgttaccattaattccgacggctggggacagtttcatgtgaacggcggc
tcggtttcgatttatgttcagaggccataa

DBGET integrated database retrieval system