KEGG   Bacillus glycinifermentans: BGLY_0770Help
Entry
BGLY_0770         CDS       T04537                                 

Gene name
yfmT
Definition
(GenBank) aldehyde dehydrogenase
  KO
K21802  vanillin dehydrogenase [EC:1.2.1.67]
Organism
bgy  Bacillus glycinifermentans
Pathway
bgy00627  Aminobenzoate degradation
bgy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bgy00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BGLY_0770 (yfmT)
Enzymes [BR:bgy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.67  vanillin dehydrogenase
     BGLY_0770 (yfmT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: SCA84593
UniProt: A0A1C3S9W3
LinkDB All DBs
Position
1:809059..810516
Genome map
AA seq 485 aa AA seqDB search
MFQITDLNRQYIGGEWRDGQSESVLADLNPYTQKTIASFHKATPDDIDQAYKAAVKAKKE
WDRVGPYEKRAILEKAAAYIEEHKEAIVFLIMEELGGTRLKAAFEIDLVINMIKEAAGFP
LKMEGRILPSPVDGKENRLYRIPAGVVGVISPFNFPFFLSVKSVAPALGAGNGVVLKPHE
ETPICGGTLIAKIFEEAGLPKGLLNVVVTDIEEIGDSFVEHPIPRIISFTGSTKVGSYIG
QLAVKHFKKPLLELGGNSALIVLEDADLEYAVNAAAFSRFTHQGQICMSANRILVQKEVY
PAFLKLFYQKVSALKTGDPMDPDTIIGPVINERQAESLRKAVEKGIEEGAVALIKGEIKG
NLVEPTILTDVKPGMAIAREELFGPVVCVMPFQTEEEAIRIANDTPFGLSGAVHTGNVER
GVELAKQIETGMIHVNDTTINDEPHIAFGGEKQSGLGRLNGEWSLDEFTTLKWISVQHQK
RVFPY
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaattaccgatctcaaccgccaatacatcggaggggagtggagagacggccaa
agcgagagcgtcttggcagatctgaacccctatacacaaaaaacgatcgcctcttttcac
aaagcgacgccggatgacatcgatcaggcctataaggcggcagtgaaagcgaaaaaagaa
tgggaccgcgtcggcccatatgagaaacgggcgattttggaaaaagcggccgcctatatt
gaggaacataaagaagcgattgtgtttctcattatggaagagctgggcgggacaaggctg
aaagcggcttttgaaatcgatcttgtcatcaatatgatcaaagaagcggccggttttccg
ctcaagatggaaggaagaattctgccttcccctgtcgatggaaaagaaaatcgcctgtac
cggattccggctggcgtcgtcggggtgatcagccctttcaattttccgttctttttatct
gtcaaatcggttgctccggcgctaggcgcgggaaacggcgtagtgctgaagccgcatgaa
gaaacgccgatctgcggcggaaccttgattgcaaaaatatttgaagaagcagggcttccg
aaggggcttttaaacgttgttgttacggacatcgaagagatcggagacagctttgttgaa
cacccgatcccaaggatcatctcgtttacgggttcgacaaaggtgggaagctacatcggc
cagcttgcggtcaagcactttaaaaaaccgctgcttgagcttggcggcaacagcgcgctg
atcgttctggaggatgccgatttggaatatgcggtcaatgccgcggcattcagccgcttc
acccatcaggggcaaatctgcatgtcggccaaccggattctcgttcaaaaagaggtgtat
ccggcctttttgaaattattttatcaaaaggtgtcagctcttaagacgggagatccgatg
gacccggatacgattatcggccctgtcattaatgaacgccaggcggaaagtctgcgcaag
gccgtagaaaaaggaatcgaagaaggcgcggttgcgctgatcaaaggcgaaattaaaggc
aatctcgtcgaaccgacgattttaacagatgtaaagccgggcatggcgatcgcgcgggaa
gagctgttcgggccggtcgtctgtgtcatgccgtttcaaacggaagaggaagccatcaga
attgcgaatgacacaccgttcgggttaagcggagccgttcatacggggaatgtggaacgc
ggcgtggagctcgccaaacagatcgaaacgggaatgatccatgtcaatgacaccacgatc
aacgacgagccgcacatcgctttcggcggagaaaaacagtcaggcctcggaaggctgaac
ggagaatggagccttgatgagtttacgacattgaagtggatctctgtccagcatcaaaaa
agggtttttccatattaa

DBGET integrated database retrieval system