KEGG   Bacillus glycinifermentans: BGLY_1158Help
Entry
BGLY_1158         CDS       T04537                                 

Gene name
comK
Definition
(GenBank) competence transcription factor ComK
  KO
K02250  competence protein ComK
Organism
bgy  Bacillus glycinifermentans
Pathway
bgy02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bgy00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BGLY_1158 (comK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bgy03000]
    BGLY_1158 (comK)
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bgy02044]
    BGLY_1158 (comK)
Transcription factors [BR:bgy03000]
 Prokaryotic type
  Other transcription factors
   Others
    BGLY_1158 (comK)
Secretion system [BR:bgy02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) related proteins
   BGLY_1158 (comK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ComK
Motif
Other DBs
NCBI-ProteinID: SCA84981
UniProt: A0A1C3SAT6
LinkDB All DBs
Position
1:1194300..1194881
Genome map
AA seq 193 aa AA seqDB search
MSNTEDLTRDSYEVNSSTMAVLPLDDGKTPASKVLETDRTFRVNMRPFQIIERSCRYFGS
SYAGRKAGTYEVIKVSHKPPIMVDHSNNIFLFPTFSSTRPQCGWLSHAHVHEFRAAKYDN
TFVTFVNGESLELPVSRASFENQVYRTAWLRTKFLDRIEGNAAPKKQEFMLYPKEDRNQL
IYEFILRELRKRY
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatactgaagatttgacaagagattcttatgaagtaaacagttcgacaatggca
gttctgcctcttgatgatggaaaaacgcccgcctcaaaagtgcttgaaaccgacaggaca
tttcgggtcaatatgagaccttttcaaatcatagagagaagctgccgctatttcggttca
agctatgcggggagaaaggccggcacgtacgaagtcattaaagtttcccataagccgccg
atcatggtggatcattcaaacaatatttttctttttcccacattctcctctacaaggcct
caatgcgggtggctttcccatgcgcatgttcatgaattccgtgcggctaagtatgacaat
acattcgttacgttcgtaaacggtgaatcgctggagctgccggtgtccagagcatctttc
gaaaatcaggtttaccgcacggcatggctgagaacgaaatttctcgaccggattgaaggg
aacgccgcgccgaaaaaacaggaatttatgctgtatccgaaggaggatcggaaccagctg
atctatgaattcatcctcagggagctgagaaagcgctattga

DBGET integrated database retrieval system