KEGG   Bacillus glycinifermentans: BGLY_2511Help
Entry
BGLY_2511         CDS       T04537                                 

Gene name
odhA
Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bgy  Bacillus glycinifermentans
Pathway
bgy00020  Citrate cycle (TCA cycle)
bgy00310  Lysine degradation
bgy00380  Tryptophan metabolism
bgy01100  Metabolic pathways
bgy01110  Biosynthesis of secondary metabolites
bgy01120  Microbial metabolism in diverse environments
bgy01130  Biosynthesis of antibiotics
bgy01200  Carbon metabolism
Module
bgy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bgy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bgy00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BGLY_2511 (odhA)
  Amino acid metabolism
   00310 Lysine degradation
    BGLY_2511 (odhA)
   00380 Tryptophan metabolism
    BGLY_2511 (odhA)
Enzymes [BR:bgy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BGLY_2511 (odhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: SCA86334
UniProt: A0A1C3SEZ5
LinkDB All DBs
Position
1:complement(2425683..2428517)
Genome map
AA seq 944 aa AA seqDB search
MFQNSMKQRMTWEEFHGPNLGYVLELYDQYVKDPESVDPDVKEMFDGLGAPPGDLRAASE
SNEGAHFTAESIEKIASAVKLAEDIRTYGHLNASVNPLRKTQEKQELFPLAEYGLTEQDV
EKIPASVICKDAPKEVTNGLEAIQYLRNTYKKSISFEFDHVHIFEERNWLMKKIESGELF
APKAKEKLVDVLRRLTEVEGLEQFLHKTFVGQKRFSIEGLDALVPMLDDMIAKSVSLGTT
NINIGMAHRGRLNVLAHVLGKPYEIIFSEFQHAPNKDLVPSEGSIGISYGWTGDVKYHLG
ANRQIQDEETKTARITLANNPSHLEFIDPIVEGSTRAAQETRTESGYPVQDVKKSLAILI
HGDAAFPGEGIVAETLNLSQLKGYQVGGAIHIIANNMIGFTTESNESRSTKYASDLAKGF
EIPIVHVNADDPEACLSAVQLAVEYRMTFNKDFLIDLIGYRRFGHNEMDEPSATQPMLYD
AVRKHPTVKNIFAEKLIDRGVIEKEAVQHIQDSVMKRLEDAYRKVPAKKEDMAHEIVPPE
PVSNGFPFVDTSVEFDILRKINEELIAWPESFNVFDKLKRILERRAKAFENDRKVDWSLA
EAMAFASILKDGTPVRLTGQDSERGTFAHRNLVLHDSKTGDEFIALHHLADTKAAFAVHN
SPLSEGSVLGFEYGYNVSSPETMVIWEAQFGDFANAAQVYFDQFISAGRAKWGQKSGLVV
LLPHGYEGQGPEHSSGRTERFLQLAAENNWTVANLTSAAQYFHILRRQAKMLLREEIRPL
IIMTPKSLLRNPNTVSEVQELTNSSFKPVYEMSGLSHQYEKVTRLVLSSGKVSIDISDFF
NKMEGDKDWIHIARVEELYPFPAKHIKEVFGKLPNLEEIVWVQEEPQNMGAWNYIEPYLR
EIAPKDVKVRYIGRRRRSSPAEGDPTVHKKEQERIVSESLTRKN
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaaatagtatgaaacaaagaatgacttgggaagaatttcacggtccgaacctc
ggctatgtgctggagctctatgatcagtatgtcaaggatccggagagcgtcgatcctgac
gtgaaagagatgtttgacggtctcggagctcccccgggtgacttaagggccgcctctgaa
agcaatgaaggggcgcatttcacggcagaatctatcgaaaaaatcgcatccgcggtaaaa
ctcgcagaagatattcgaacctatggccatttaaacgcttccgtcaatcctttgagaaaa
acgcaagaaaaacaagagctttttccgcttgctgaatacggtctgaccgagcaggatgtg
gaaaaaatcccggcatcggtgatttgcaaagatgccccaaaagaagtaacgaacggttta
gaagccatccagtacttaaggaacacatacaaaaaatcgatctcttttgaattcgaccat
gtgcatatttttgaagagcgcaattggctgatgaagaagatcgaatcgggggaattattc
gcaccgaaagcgaaagagaaattagtagacgtcttaagaaggctgacagaggttgagggg
cttgaacagtttttgcacaaaacgtttgtcgggcaaaagcgcttctcgatcgaagggctt
gatgcgctcgtgcctatgctggatgatatgatcgccaagtcggtttccctcggtacgacg
aacatcaatatcggaatggcgcataggggacgcctgaacgtattggcccatgtgctcgga
aaaccgtacgaaatcattttttccgaatttcagcatgctccgaacaaagatctcgtccct
tctgagggatcgatcggaatcagctacggctggacgggggatgtaaaataccatctcggt
gcaaaccgccagattcaggatgaagagacaaagacggcgcggatcaccttggcgaacaat
ccgagccaccttgaattcatcgatccgattgtagagggctctacaagggcagcacaggaa
acgagaacggagagcgggtatccggttcaagacgtcaaaaaatcgctggcgattctgatc
cacggcgatgctgcgttcccgggagaaggcatcgtcgctgaaaccttgaacctcagtcag
ctgaagggctatcaggtcggcggagcgatccacatcatcgccaacaacatgatcggattt
acaaccgaaagcaatgagtcgagatcgacgaaatacgcgagcgacctggccaaaggtttc
gaaattccgattgtccacgtcaacgccgacgatcctgaagcctgcctttcagcggttcag
cttgcagtcgagtaccgtatgactttcaacaaggactttttgatcgatctgatcggctac
cgccgcttcggacacaatgagatggatgaaccgtcggcgacgcagccgatgctgtacgat
gcggtcagaaagcatccgacggtcaaaaatatttttgcagaaaagctcatcgatagggga
gttattgaaaaagaggccgttcaacacattcaagactcggtcatgaagcgtttggaagat
gcgtaccgaaaagtgccggcgaaaaaggaagacatggcgcatgaaatcgttccgccggag
ccggtttcaaacgggttcccgtttgtcgacacatccgttgaatttgacattctgcgcaaa
attaacgaagagctgatcgcatggccggaaagcttcaacgtgttcgacaagttaaagcga
atcctcgaaaggcgcgccaaagcgtttgaaaatgaccggaaagtcgattggtctttggcc
gaggcgatggcgtttgcgtccattttgaaagacggcacgcctgtaaggctgaccggccag
gattcagaacgcggcacatttgcacatcggaaccttgttcttcatgacagcaagacaggg
gacgaattcatcgccctgcatcaccttgcagatacaaaagcggcatttgcggttcacaac
agcccgctttctgaagggtctgtccttggctttgaatacggttataacgtttcttcgccg
gaaacgatggtgatctgggaagcgcagttcggagatttcgcgaacgcagctcaagtatat
tttgatcagtttatttctgcaggcagggccaaatgggggcaaaaatccgggcttgtcgtc
ctgctccctcacggatatgaagggcagggacctgagcattcgagcggcagaacggagcga
ttcctccagcttgcagcggaaaataactggactgtcgccaatctgacaagcgcggcgcaa
tacttccatattttaagaaggcaggcgaaaatgctgctgcgtgaggagatccgcccgctc
attatcatgacgccgaaaagcctgctgagaaatccgaacaccgtttcagaagtacaagag
ctgacaaacagcagctttaagcctgtttacgaaatgtccggtctttctcatcagtatgaa
aaagtgacacgcctcgtcctttcaagcggcaaagtctcaatcgacatcagcgatttcttt
aacaagatggaaggcgacaaagactggatccatattgccagggtcgaagaactttatcca
ttccctgcaaagcatattaaggaggtctttggcaaactgccgaacttggaagaaatcgtt
tgggttcaggaagaaccgcaaaatatgggggcttggaattacattgagccttatttaagg
gaaattgcccctaaagacgttaaagtgcgctatattggaagaagaagacgttcaagtccg
gcagaaggggatccgacggttcataagaaggaacaggaacgcattgtatctgagagcttg
actcgcaaaaactaa

DBGET integrated database retrieval system