KEGG   Bacillus glycinifermentans: BGLY_3139
Entry
BGLY_3139         CDS       T04537                                 

Gene name
levG
Definition
(GenBank) Fructose permease IID component
  KO
K02771  fructose PTS system EIID component
Organism
bgy  Bacillus glycinifermentans
Pathway
bgy00051  Fructose and mannose metabolism
bgy02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bgy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BGLY_3139 (levG)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BGLY_3139 (levG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bgy02000]
    BGLY_3139 (levG)
Transporters [BR:bgy02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    BGLY_3139 (levG)
SSDB
Motif
Pfam: EIID-AGA DUF5101
Other DBs
NCBI-ProteinID: SCA86962
UniProt: A0A0J6EN26
LinkDB
Position
1:complement(3044051..3044878)
AA seq 275 aa
METEKRLTKREIFSMFIRSNFLLGSFNFERVQAMGYCYVMIPAIKKLYGPGAKRNEALQR
HLEWFNTHPWLTAPIFGVTAAMEEEMANQKGIDAKAISGMKIGLMGPLAGVGDPIFWGTL
RPVLAALGASLALGGNIAGPLLFFFFINAIRLSTKYYGLKYGYVKGMEILQDLVGNRIQK
LTEGASILGLFVMGALVSKWTTINIPIVVSRIKNESGKVEVQTVQSILDSIMPGVLPLGL
TLLVAWMLRKGVNPLLIIFGIFIIGILGYWAGFLA
NT seq 828 nt   +upstreamnt  +downstreamnt
atggagacagaaaaaagattaacaaagagagaaattttcagcatgttcattcgttcaaat
tttttgctcggatcttttaactttgagcgtgtgcaggcaatgggctattgctatgtgatg
attccggcgattaaaaaactgtacggtccgggagcgaaaagaaacgaagcattgcagcgc
catctcgaatggttcaatacacacccgtggctgacagcaccgatattcggcgtgacggcc
gccatggaagaagagatggccaatcaaaaaggaattgatgcaaaagcgatcagcggtatg
aaaatcgggttaatgggaccgctcgcgggtgtgggcgatccgattttctgggggacgctg
cgcccggtgttagcggctttgggggcatcgctcgccttaggagggaacattgccgggcct
ctgctgttctttttcttcatcaatgccataagattaagtacgaaatattacggtttaaag
tacggctatgtgaaaggaatggaaattcttcaggatttggtcgggaaccggattcaaaag
ctgaccgaaggcgcttcgatactcggattgtttgtcatgggggctcttgtctcaaagtgg
accaccatcaacatcccaatcgtcgtttccagaattaagaacgaatcaggcaaagtggag
gttcaaacggtgcagagtattttggacagcatcatgccgggggtgctgcctttaggtttg
acgctgctcgtcgcgtggatgctgcgaaaaggcgtgaatccgcttcttattatattcggc
atttttatcatcggtattctcggttattgggccggttttttggcataa

DBGET integrated database retrieval system