KEGG   Bacillus glycinifermentans: BGLY_3140
Entry
BGLY_3140         CDS       T04537                                 

Gene name
levF
Definition
(GenBank) Fructose permease IIC component
  KO
K11196  fructose PTS system EIIC component
Organism
bgy  Bacillus glycinifermentans
Pathway
bgy00051  Fructose and mannose metabolism
bgy02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bgy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BGLY_3140 (levF)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BGLY_3140 (levF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bgy02000]
    BGLY_3140 (levF)
Transporters [BR:bgy02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    BGLY_3140 (levF)
SSDB
Motif
Pfam: EII-Sor TMEM251
Other DBs
NCBI-ProteinID: SCA86963
UniProt: A0A1C3SG96
LinkDB
Position
1:complement(3044903..3045709)
AA seq 268 aa
MSSIQIILLLIIAGITGIASVLDEGQTHRPLIACTLVGLVLGDLKTGIILGGTLELMALG
WMNVGLAMAPDTAIASVISTILVITADQGIGEGIAVAVALAAAGQALTIFVRTITVFLIH
RADKYAKDGNMKGIEIMHITAMVFQALRVMIPTLIVALISVSAVQAFLGNIPEVITKGLQ
VGGGIIVVVGYAMVINMMNIPYLKPFFYIGFLLAAFTDFNLVGFGALGLCLALLYQQVMQ
KNSAQGAVAAAAANSSSAAYDDDDDLDA
NT seq 807 nt   +upstreamnt  +downstreamnt
atgtcttcaatacaaattatattgctgttgattattgcaggcattaccggtatcgcaagc
gtattggacgagggacagacgcaccgtccgctgattgcctgtacattggtcggcttggtg
ctcggagacctgaaaaccggcatcattttgggcggaacccttgaactgatggccttgggc
tggatgaatgtcggcctcgccatggcgccggatacagccatcgcttctgtaatctcaacc
attttggtgattaccgccgatcagggaatcggcgaaggaattgccgtcgcagtggcattg
gcagctgcagggcaggcgctgacgatttttgtccgcacgattaccgtctttttaatccac
cgcgctgacaaatacgccaaggatggaaatatgaaaggtatcgaaatcatgcatattaca
gcaatggtgtttcaggcgctcagagttatgatcccgacgttgattgtggcgctgatcagc
gtcagcgctgttcaggctttcttagggaatattcccgaagtcattacaaaaggtctccag
gtaggcggaggaattatcgttgtcgtcgggtatgcgatggtgatcaatatgatgaacatt
ccttacttgaagccattcttctacatcggctttttgttggcggcgtttacagacttcaat
ctggtcgggttcggcgctctcggactgtgccttgcccttctgtatcagcaggtcatgcaa
aaaaacagcgcgcagggagcggtcgcagcagcagccgcaaacagcagctcggctgcttac
gatgatgatgatgatcttgatgcctaa

DBGET integrated database retrieval system