KEGG   Bacillus glycinifermentans: BGLY_3142
Entry
BGLY_3142         CDS       T04537                                 

Definition
(GenBank) PTS system fructose-specific transporter subunit IIA
  KO
K11194  fructose PTS system EIIA component [EC:2.7.1.202]
Organism
bgy  Bacillus glycinifermentans
Pathway
bgy00051  Fructose and mannose metabolism
bgy02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bgy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BGLY_3142
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BGLY_3142
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bgy02000]
    BGLY_3142
Enzymes [BR:bgy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.202  protein-Npi-phosphohistidine---D-fructose phosphotransferase
     BGLY_3142
Transporters [BR:bgy02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    BGLY_3142
SSDB
Motif
Pfam: EIIA-man Rad50_zn_hook
Other DBs
NCBI-ProteinID: SCA86965
UniProt: A0A1C3SGD6
LinkDB
Position
1:complement(3046217..3046648)
AA seq 143 aa
MISVIISGHGDFPIALKESSNMIFGEEDHLTAVPFLKGEGIQTLQKKYQQTLKRIPKEHE
VLFLVDIFGGTPYNAAAPYIVKDQRMDMAAGVNLPILLEALSLRGHMPLKELLNRLKTMS
QESFQVCSEHLEHAIRAEREDKL
NT seq 432 nt   +upstreamnt  +downstreamnt
atgatttcagttattatcagcggtcatggagattttccaatagcactgaaagagtcgtca
aacatgattttcggcgaagaagaccatctgacggcggtgccgtttttgaaaggggaaggc
atccaaacattgcagaaaaaatatcagcagacgctaaagcgcattccaaaggaacatgag
gtgctgtttttagtggatatatttggcggaacgccatacaacgcggccgctccttatatc
gtgaaggatcaaagaatggatatggcggccggggtgaacctgccgatcctgctggaggca
ttaagcctgagaggacatatgccgcttaaagaactgctgaacaggctgaaaacaatgagt
caggaaagcttccaggtgtgcagcgaacatttagaacatgcgataagagccgaaagagag
gataaattgtga

DBGET integrated database retrieval system