KEGG   Bacillus glycinifermentans: BGLY_3216Help
Entry
BGLY_3216         CDS       T04537                                 

Definition
(GenBank) TrkA domain-containing protein
  KO
K07228  TrkA domain protein
Organism
bgy  Bacillus glycinifermentans
Brite
KEGG Orthology (KO) [BR:bgy00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BGLY_3216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrkA_C Castor_Poll_mid
Motif
Other DBs
NCBI-ProteinID: SCA87039
UniProt: A0A1C3SHE6
LinkDB All DBs
Position
1:complement(3120113..3120607)
Genome map
AA seq 164 aa AA seqDB search
MRMREFDLPGIGRKVEMFTRDAEKITIILHENGMRELYHFHEHDDEECVSSMCFDDDEAR
QISAILGGVAYKPRAIETVEAAIDELAIEWFKIEAGSEAAQQTISSLGIGKHYGVTVIGV
VKKGGDKILNPVSETMMNEGDTLVISGEKKELRRLIQEKLTASG
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgagaatgcgcgaatttgatctgcccggcatcggcagaaaagtagaaatgtttacgcgc
gacgcggaaaagataacgattattcttcatgaaaacggaatgagagagctgtatcacttc
catgaacatgatgatgaagaatgcgtgtcatccatgtgctttgatgatgatgaggcaagg
caaatatcggcgatcctcggaggcgtcgcgtacaagccaagggcaatcgaaacagtcgaa
gctgccattgatgagctggcaatcgaatggtttaaaatagaagctggatcagaggccgca
cagcaaacgatcagttccctcggaatcggcaaacactacggcgtcaccgtgatcggcgtc
gtcaaaaaaggcggtgacaaaattctaaacccggtttcagagacgatgatgaatgaaggt
gatacgctggtgatttccggagaaaaaaaagaattaagacgcctcattcaggaaaagctg
accgcgtcagggtaa

DBGET integrated database retrieval system