KEGG   Bacillus glycinifermentans: BGLY_4227Help
Entry
BGLY_4227         CDS       T04537                                 

Gene name
kduI
Definition
(GenBank) 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase
  KO
K01815  4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase [EC:5.3.1.17]
Organism
bgy  Bacillus glycinifermentans
Pathway
bgy00040  Pentose and glucuronate interconversions
bgy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BGLY_4227 (kduI)
Enzymes [BR:bgy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.17  5-dehydro-4-deoxy-D-glucuronate isomerase
     BGLY_4227 (kduI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: KduI
Motif
Other DBs
NCBI-ProteinID: SCA88050
UniProt: A0A1C3SJC0
LinkDB All DBs
Position
1:4083509..4084336
Genome map
AA seq 275 aa AA seqDB search
MENRYSVHPEQAKRFTTAELREHFLIESLFVENQVNMFYSHEDRVVIGGAVPVKEPLKLD
AGDFLKTDYFLERREIGIVNVGQAGAVKVNGEKHVLGHKDFLYIGLGNKDVYFSSLNEGA
AKFYFVSATAHQHYPVQKAALSELPYDHLGDEASSNVRNLYKVIHADGIKSCQLMMGITF
LEQNNTWNTMPAHVHDRRMEVYLYLDLDEDERVFHFMGEPTETRHLVVGNEQAVISPAWS
IHSGSGTSNYCFIWAMAGENYTFKDMDAVPMNVIR
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatcgttattctgttcatcctgaacaggcaaaacgcttcacgaccgcagaactt
cgcgagcattttttaatagagtcattgtttgtggaaaatcaagtgaatatgttttattcg
catgaagacagggtggtaatcggcggggccgttccggtcaaggagccgcttaaactcgat
gcaggcgactttttgaaaacggattatttcctcgaacggcgcgagatcgggatcgtgaac
gtcggacaggcgggcgccgtaaaggttaacggtgaaaagcacgttttggggcataaagat
tttctgtatatcggactcgggaacaaagacgtttacttctcaagcttgaatgaaggcgct
gccaaattttatttcgtttcggcaacggcgcatcagcattacccggtgcaaaaagccgcg
ctttccgaacttccgtatgatcaccttggggatgaagcgtcttcgaatgtccgcaacctt
tataaagtgatccatgcagacgggatcaaaagctgccagctcatgatgggcattacgttc
ctcgaacaaaacaatacgtggaatacaatgccggcccatgttcatgaccgccggatggaa
gtatatctttaccttgacctcgacgaagatgagagagtgtttcatttcatgggcgaaccg
acggaaacgcgccacctcgtcgtcggcaatgagcaggctgttatttctcccgcctggtcg
attcattctgggtccggaacatcgaactactgctttatttgggcgatggccggtgaaaat
tatacatttaaggacatggatgctgtcccgatgaatgtcattcggtaa

DBGET integrated database retrieval system