KEGG   Bacillus glycinifermentans: BGLY_4678Help
Entry
BGLY_4678         CDS       T04537                                 

Gene name
ahpF
Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bgy  Bacillus glycinifermentans
Brite
KEGG Orthology (KO) [BR:bgy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BGLY_4678 (ahpF)
Enzymes [BR:bgy01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BGLY_4678 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 Thioredoxin_3 FAD_oxidored GIDA HI0933_like AlaDh_PNT_C Thi4 DAO FAD_binding_3 NAD_binding_7 Glutaredoxin NAD_binding_8 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: SCA88501
UniProt: A0A1C3SKY3
LinkDB All DBs
Position
1:4546290..4547819
Genome map
AA seq 509 aa AA seqDB search
MVLEANIKAQLNQYMQLIENDIVLKVSAGEDDVSKDMLALVEELASMSSKVTVEKAQLNR
TPSFSVNRAGEETGITFAGVPLGHEFTSLVLALLQVSGRPPKVDQKIIDQIKNISGEYHF
ESYISLTCHNCPDVVQALNMMSVLNPNITHTMIDGAAYKSEVESKNIMAVPTVFLNGESF
GSGRMTIEEILAKMGSGTDTSELSDKDPFDVLVVGGGPAGASAAIYAARKGIRTGIVAER
FGGQVLDTMSIENFISVKRTEGPKLAASLEEHVKDYDIDVMNLQRAKHLEKKDLFELELE
NGAVLKSKTVILSTGARWRNIGVPGEQEFKNKGVAYCPHCDGPLFEGKDVAVIGGGNSGI
EAAIDLAGIVNHVTVLEFAPELKADEVLQKRLYSLPNVTVVKNAQTKEITGEENVNGITY
VDRETGAEKHVELQGVFVQIGLVPNTEWLPETVERNRIGEIVVDKRGETTIPGLFAAGDC
TDSPYNQIIISMGSGANAALGAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
ttggtacttgaagcaaatatcaaagcacaattaaaccaatacatgcagctaattgagaat
gacattgttctcaaagttagcgcaggcgaagatgacgtctcaaaggatatgctggctctc
gttgaagagctggcatccatgtcatccaaagtcactgtcgaaaaagcgcaattaaacaga
acgccaagcttcagcgtcaatcgtgccggagaagaaaccggcatcacattcgccggtgta
ccgctcggacacgaattcacttcattagtgctggcgcttttgcaagtgagcggaagaccg
cctaaagtcgatcaaaaaatcatcgatcaaatcaaaaacatcagcggcgaataccacttt
gaatcttatatcagcctgacgtgccacaactgccccgacgttgtccaagctttgaacatg
atgagcgtgctcaacccgaatatcacacacaccatgatcgacggcgcggcatacaaatct
gaagttgaaagcaaaaacatcatggcagtgccgaccgtattcctgaacggcgaatcattc
ggaagcggccgcatgacaatcgaagagattcttgcgaagatgggcagcggcacagacacc
tctgagctttctgacaaagatccgttcgatgtccttgtcgtcggcggcggtccggccggt
gcaagcgcagcgatctatgcggcccgcaaaggcatccgcacaggcattgtcgctgaacgc
ttcggcggtcaggtccttgacacgatgagcatcgagaacttcatcagcgtaaaacgcacc
gaaggaccgaagctcgcagcaagtcttgaagaacacgtgaaggattatgatattgacgtc
atgaatcttcagcgcgcaaaacatctcgagaaaaaagatctgttcgagcttgaactcgaa
aacggcgctgttctgaaaagcaaaaccgtgatcctttcaacaggagcgcgctggcgcaat
atcggcgtacccggcgaacaagagttcaaaaacaaaggtgtcgcatactgccctcactgt
gacggaccattgtttgaaggcaaagacgtagccgtcatcggcggcggcaactccggaatc
gaagcagcgattgacctcgcaggcatcgtcaatcatgtcactgttcttgagtttgcgccg
gagctgaaagctgacgaagttctgcaaaaacgtctctacagcctccctaacgtgactgtc
gtgaaaaacgcacagacaaaagaaatcacaggcgaagaaaacgtaaacggcatcacgtac
gtagaccgcgaaactggagcggaaaaacacgtcgaactccaaggcgtcttcgtccaaatc
ggtctcgtaccaaacacggaatggctgcctgaaaccgtcgaacgcaaccgcatcggcgaa
atcgtagtcgacaaacgcggcgaaacaaccatcccaggcctgttcgctgcaggcgactgc
acagacagcccgtataaccaaatcatcatttcgatgggatctggtgcgaatgctgcgtta
ggagcgtttgattacctgattcggaattaa

DBGET integrated database retrieval system