KEGG   Bacillus halodurans: BH0520Help
Entry
BH0520            CDS       T00039                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bha  Bacillus halodurans
Pathway
bha00473  D-Alanine metabolism
bha01100  Metabolic pathways
bha01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bha00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BH0520
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BH0520
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bha01011]
    BH0520
Enzymes [BR:bha01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BH0520
Peptidoglycan biosynthesis and degradation proteins [BR:bha01011]
 Precursor biosynthesis
  Racemase
   BH0520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C PrmC_N
Motif
Other DBs
NCBI-ProteinID: BAB04239
UniProt: Q9KFF9
LinkDB All DBs
Position
547762..548928
Genome map
AA seq 388 aa AA seqDB search
MEHFYRDTWVEVDLDAIEQNVTNALRLYKDREMNLMAVVKANGYGHGAVEVSQAALRAGA
SYLSVAFLDEALALRKAGIDAPILVMGLVGAEHVQLAIKHRITLTVYQLDWLEQAISRLH
TRDKLAIHLKLDTGMGRIGLRRKEDIRSCMDFIASHECFELEGVFTHFATADEKDLTYFK
KQCQRFNQWLEYIREWQLPIRYVHCGNSAAGLRFPEKNFNMFRFGIAMYGLTPSPEITDE
LPFPLKQAFSLKSRLSNVKKLPKGEGISYGATYVTEGAEWIGTLPIGYADGWIRHHSNAG
GHVLIDGKRAPFVGRICMDQCMIRLPKKHSIGDTVTLIGESDGKQITMDEVAKRLNTINY
EIPCVISWRVPRIYFRDGQIISVKNNLL
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
gtggaacatttttatcgagacacttgggtagaagttgacttagatgcgattgaacaaaat
gtgacgaacgctcttcgtctttataaagacagggaaatgaatttgatggctgtcgtaaaa
gcaaacggttatggtcatggtgctgtagaagtcagtcaagctgctttacgcgcaggggcg
tcttatttgtctgttgcttttttagatgaagccctcgctttgcgaaaagcaggaatcgat
gcccccattctggtcatgggtctagtgggcgctgagcatgttcagctagccatcaaacat
cgtattacgttaaccgtttatcaattggactggctggaacaagcgatctctcgcttgcac
actagagacaagctagccattcatttaaagctagatactggaatgggacgaattggatta
cggcgaaaagaggatattcgctcatgtatggattttatcgcatcccacgaatgctttgaa
ttagaaggagtttttacccattttgccacagctgatgagaaggatttaacgtattttaag
aagcaatgtcaacgatttaatcagtggcttgagtacattcgtgaatggcagttgcccatt
cggtacgttcattgcggcaatagtgcagcaggccttaggtttcctgagaaaaattttaat
atgttccgctttggcatcgccatgtacgggctcaccccatcccctgaaataacagatgag
cttccattcccattaaagcaggctttttcattaaaatcacgactctccaacgtgaaaaaa
ctaccgaaaggagaaggcattagctatggagctacgtatgtgacagagggtgctgaatgg
attggtactctgccgatcgggtacgcagatggttggattcgccatcattccaatgctgga
gggcatgttttgatcgatggaaagcgggctccttttgttggtcggatttgtatggatcaa
tgtatgattcgtttaccgaaaaaacattcaattggtgatacagtaacgttaatcggggaa
agtgatgggaagcaaattacgatggacgaagtagcaaaacggctgaacaccattaactat
gaaattccttgcgtgatttcgtggcgggtaccgcgtatatattttcgagatggacaaata
atatctgttaaaaataaccttttgtga

DBGET integrated database retrieval system