KEGG   Bacillus halodurans: BH0667Help
Entry
BH0667            CDS       T00039                                 

Definition
(GenBank) glutamyl-tRNA (Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
bha  Bacillus halodurans
Pathway
bha00970  Aminoacyl-tRNA biosynthesis
bha01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bha00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BH0667
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bha03029]
    BH0667
Enzymes [BR:bha01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BH0667
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BH0667
Mitochondrial biogenesis [BR:bha03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BH0667
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey Aconitase_B_N
Motif
Other DBs
NCBI-ProteinID: BAB04386
UniProt: Q9Z9X0
LinkDB All DBs
Position
719850..721280
Genome map
AA seq 476 aa AA seqDB search
MNFETVIGLEVHVELKTESKIFSASPNHFGAEPNANTSVIDLGYPGVLPVLNKAAVEFAM
KAAMALNCEVATDTKFDRKNYFYPDNPKAYQISQFDKPIGENGWIEIEVDGTKKKIGITR
LHLEEDAGKLTHSGNGYSLVDFNRQGTPLIEIVSEPDIRTPQEAYAYLEKLKSIIQYTGV
SDCKMEEGSLRCDANISLRPVGQEEFGTKTELKNLNSFNFVRKGLEYEEKRQAQVLLSGG
EILQETRRYDEAANKTVLMRVKEGSDDYRYFPEPDLVALHIDDEWKARIRSEIPELPDAR
KKRYVEELGLPAYDAMVLTLTKEMSDFFEETIAKGADPKLASNWLMGEVSGYLNAEQKEL
DEVALTPDGLAKMIQLIEKGTISSKIAKKVFKDLIEKGGDPEEIVKAKGLVQISDEGELR
KYVVEVLDNNQQSIDDFKNGKDRAIGFLVGQIMKATKGKANPPMVNKLLLEEINKR
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaactttgaaacggtgattggacttgaagtccacgtagaattaaaaacggaatctaaa
attttctcggctagcccgaaccatttcggtgcagagccgaacgccaacacgagtgtcatt
gatttaggctatccaggtgtcttgcctgtcttgaataaagcagcggtggagtttgcgatg
aaggctgcaatggcacttaactgcgaagttgcgaccgacacgaaatttgaccggaaaaac
tacttctatccagacaatccgaaggcgtaccaaatttctcaatttgacaagccgatcggt
gaaaatggttggattgaaattgaggtagatggaacgaaaaagaaaatcggcattacgcgc
ctgcatttagaagaggatgcagggaaactaacccatagtggcaacggctattcactcgtt
gactttaaccgccaagggactccacttattgagatcgtctcagagccggatatccgcaca
ccacaagaggcgtatgcgtacttagaaaagcttaaatcgatcattcaatatacaggtgtt
tccgattgtaagatggaggaaggctcgctccgttgtgatgcgaacatttccttacgtcct
gttggtcaagaagaattcggaacgaaaacagagcttaaaaacttaaactcgttcaacttt
gtgcgcaaaggcttggaatacgaagaaaaacggcaggcgcaagtgcttctctctggtgga
gagattttacaagagacgcgtcgttatgacgaagctgccaataaaacagtgctcatgcgg
gtcaaggaaggctctgatgactatcgttacttccctgagccagacttagtggcccttcat
attgatgatgaatggaaagcgcgcatccgctctgaaattcctgaactgccagatgcacgg
aagaagcggtatgtggaggagcttggactaccagcatatgacgcgatggtgcttacgtta
acgaaagagatgtccgatttctttgaagagacgatcgcgaaaggtgccgatccgaagctt
gcgtcaaactggctaatgggagaggtttcaggctacttaaatgctgagcaaaaagagcta
gatgaagtggcgctgacacctgacggactggcaaaaatgattcaattgattgaaaaagga
accatctcctcaaaaatcgcgaaaaaagtgtttaaagatttaatcgaaaaaggcggcgat
ccagaggagattgtcaaagcaaaagggcttgtgcaaatttcggacgaaggcgagctacgc
aagtatgttgttgaagtactcgataacaaccagcaatcaatcgatgatttcaaaaacgga
aaagaccgtgcaattggcttccttgtcggtcaaatcatgaaagcgacaaaaggaaaagcg
aatccgccaatggtcaacaagctattgctagaagaaatcaacaaacgctaa

DBGET integrated database retrieval system