KEGG   Bacillus halodurans: BH0799Help
Entry
BH0799            CDS       T00039                                 

Definition
(GenBank) methionine gamma lyase
  KO
K01761  methionine-gamma-lyase [EC:4.4.1.11]
Organism
bha  Bacillus halodurans
Pathway
bha00270  Cysteine and methionine metabolism
bha00450  Selenocompound metabolism
bha01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bha00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BH0799
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BH0799
Enzymes [BR:bha01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.11  methionine gamma-lyase
     BH0799
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_5 Aminotran_1_2 Beta_elim_lyase Met_gamma_lyase DegT_DnrJ_EryC1 SelA DUF3216
Motif
Other DBs
NCBI-ProteinID: BAB04518
UniProt: Q9KEQ0
LinkDB All DBs
Position
871745..872926
Genome map
AA seq 393 aa AA seqDB search
MKRDQHFETRAIHTGYKPNEHFDSLTPPIYQTSTFTFASMEQGGNRFAGEEAGYVYSRLG
NPTVQILEQRIAELEGGEAALAFGSGMAAVSAILVGLTKANDHILVSNGVYGCTFGLLTM
LKEKYNIDATFSPMDSVEEILANIQDNTTCIYVETPINPTMQLIDLELVVRVAKEKGIKV
IVDNTFATPYLQQPIALGCDFVVHSATKYIGGHGDVVAGVLIGDKETIQLIRKTTQKDMG
GVISPFDAWLLLRGLKTLAVRMDRHCENAEKLAEKLKEHPKVSTVLYPGDFEHPDHSIVA
KQMKKGGGLLSFEIKGTEADIAKVVNQLKLIRIAVSLGDAETLIQHPATMTHAVVPEKRR
TQMGISKKLLRMSAGLEAWQDVWADLEQALNQL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
ttgaagcgagatcaacattttgaaacaagagcgattcatacaggctataagcctaacgag
cattttgacagcttaaccccaccgatttatcaaacctcaacgtttacgtttgcttccatg
gagcaaggaggtaatcgttttgctggggaggaagctggctatgtttattcaaggttaggc
aatccgaccgttcagattcttgaacagcggatagcagagctagaaggaggagaagctgcc
ctggccttcggttcagggatggccgcagtctctgccattcttgttggcttgacgaaagca
aacgaccatatccttgtctcaaatggtgtgtacgggtgtacgttcggtttgctcactatg
ctgaaagaaaaatacaacattgacgcaacgttttcgccaatggactcagttgaggaaatc
ttagcaaacattcaagataacacgacgtgtatttatgtggaaacaccgatcaatccaacg
atgcagttaatcgaccttgagcttgtcgtgagggtagcaaaagaaaaagggataaaagta
attgtcgataatacatttgccactccgtacttacagcaaccgatcgcattaggatgtgat
ttcgttgtccacagtgcgacgaaatacattggcgggcatggcgacgttgtggcaggcgta
ttaattggcgacaaagaaacgattcaactgattcgaaaaacaacgcaaaaagatatgggt
ggcgtcatttctccgtttgatgcatggttattgctacgggggttaaagacgttagcggtc
cgaatggatcgtcactgtgaaaacgctgaaaaactagcggaaaaactaaaggaacacccg
aaggtaagcacggttctctatccaggtgattttgagcaccctgatcattcgatcgttgca
aagcaaatgaaaaaagggggcgggctactctcatttgagataaaaggaacagaggcagac
atagcgaaagttgttaatcagcttaagctcattcgaattgccgttagtttaggtgatgcg
gaaacattaattcaacaccccgcgacgatgacacatgccgtcgttcctgaaaaaagacgg
acccaaatggggatctctaaaaaattgctacggatgtctgctggtcttgaagcttggcaa
gacgtgtgggcagatttagagcaagcattaaatcagttgtag

DBGET integrated database retrieval system