KEGG   Bacillus halodurans: BH1005Help
Entry
BH1005            CDS       T00039                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K21802  vanillin dehydrogenase [EC:1.2.1.67]
Organism
bha  Bacillus halodurans
Pathway
bha00627  Aminobenzoate degradation
bha01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bha00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BH1005
Enzymes [BR:bha01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.67  vanillin dehydrogenase
     BH1005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: BAB04724
UniProt: Q9KE53
LinkDB All DBs
Position
1082516..1083973
Genome map
AA seq 485 aa AA seqDB search
MFNIQDLNKQYIDGEWRDGKSPRVLRDRNPYNQEVLAEFQIATDSDVDAAYHAALKAQNE
WATVNPYRKREILERAVTYIEEHEEEIVAIIIDELGGTRLKAAFEIGLVKNMIKEASTFP
LRMEGKILPSTENGKENRLYRVPAGVVGVISPFNFPFFLSVKSVAPALGAGNGVVLKPHE
ETPITGGTLIAKIFEEAGVPKGLLNVVVTEIDEIGNAFVEHPIPRIISFTGSTNVGSHIG
QLAVKHFKKPLLELGGNSAFLIFADADLDYAVQAATFSRFTHQGQICMSANRIFVQRDVY
DEFVERYVTKVASLKVGDPRDPETVIGPVMNSRQAETLKQAIESGIAAGAKPVLHGAISG
NMVEPTILIDASPEMAIAQEELFGPVVCVIPFDTEEEAVEMANDTKYGLSGAIHTANVER
GVEIAKRIQTGMIHVNDITINDEPIVAFGGEKHSGLGRLNGEWSLEEFTTLKWVSVHYSQ
RVFPY
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtttaacatccaagatttaaataaacagtacattgatggagaatggagggatggaaaa
agccctcgggtacttcgtgatcgaaatccgtacaatcaagaagtattagctgaatttcaa
attgcaacggattcagatgttgacgcggcttaccatgcagctttaaaagcacagaatgaa
tgggccactgtgaatccatatagaaagcgagagattcttgaacgggccgttacctacatc
gaagaacatgaagaggaaatcgttgcaatcattatcgacgaattaggtggcacacgttta
aaagcggcttttgaaatcggacttgtaaaaaacatgatcaaggaagcctccacctttcct
ctaagaatggaaggaaagattttaccttccacggaaaatgggaaggaaaatcgactgtat
cgtgtcccagctggggtcgtgggtgttattagtccttttaattttcctttctttttatct
gttaaatcggtggcaccggctttaggggctggaaatggtgttgtgttaaagccacatgaa
gaaacgccgattaccggaggaacgttgattgccaaaatttttgaagaggccggtgttcca
aaggggctcttaaatgtcgtcgtgactgaaattgatgaaattggcaacgcttttgttgag
catccgattcctagaatcatttcatttacaggctcgacgaatgtcggtagccacatcggt
caactcgcggtaaagcatttcaagaagccgctgttggagctaggtggcaacagtgccttt
cttattttcgctgatgcggatcttgactatgcggttcaagctgcaacatttagtcgtttt
actcatcaaggccaaatatgtatgtcggccaaccgaatcttcgtccaaagagatgtatat
gatgagtttgttgagcgctacgtaaccaaagtcgcttcgcttaaagtaggggatccaagg
gaccctgaaacagtcatcggtcctgttatgaacagcaggcaagcagaaacacttaaacaa
gcaattgagagcggaatagcggcaggtgcaaagcctgttttacatggagctattagtgga
aatatggtcgaacctaccattttaatcgatgcctcgccggagatggcgattgctcaagaa
gaactctttggtcctgtcgtttgcgtcattccgtttgatacggaagaggaagcggttgaa
atggctaacgatacaaaatacgggcttagtggcgcgattcatactgcgaatgtggaacgt
ggcgttgaaatcgctaagcgtattcaaacaggaatgattcatgtaaatgacattacgatc
aatgacgagccgattgttgcttttggcggggaaaaacattctgggctgggacgattgaac
ggtgagtggagcttagaagaatttacgacattaaaatgggtatcagttcactatagtcaa
cgggttttcccatattaa

DBGET integrated database retrieval system