KEGG   Bacillus halodurans: BH1233Help
Entry
BH1233            CDS       T00039                                 

Gene name
spoVB
Definition
(GenBank) involved in spore cortex synthesis
  KO
K06409  stage V sporulation protein B
Organism
bha  Bacillus halodurans
Brite
KEGG Orthology (KO) [BR:bha00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bha02000]
    BH1233 (spoVB)
Transporters [BR:bha02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   BH1233 (spoVB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polysacc_synt Polysacc_synt_C MatE MurJ DUF3021
Motif
Other DBs
NCBI-ProteinID: BAB04952
UniProt: Q9KDI0
LinkDB All DBs
Position
complement(1324752..1326320)
Genome map
AA seq 522 aa AA seqDB search
MSKQTFLKGTFILIIAGLITRFLGFVNRIVVARIMGAEGVGLYVMAVPTLLLVITITQFG
LPVAISKLVAEADALNDRSRIKRILVVSTTITLTLSIVFTTAMILLAPMIASTLLTDSRA
YWPLVAISPIVPIVALSSVMRGYFQGLQNMKPTAYSQVIEQVVRITFVALLTSAFLPLGV
EYAAAGAMISVVLGELASLLYMIVMFKRKKSFRIRQKFFAYLGEGKKTFVDLMAISVPTT
GSRLVGSVSYFFEPIVVAQSLALAGVATAVATQQYGQLAGFVIPLLTLPTFITYSLSVSL
VPAISEAAAKKRYPLIHHRLGQALRLAMLSGGISVVVLYVFAEPVMALMYDAPEAAVFIK
VMAPFTIFLYFQGPLQSTLQALNLAKAAMMNSFYGAIVKIAAIFALATRPELGIMGAALA
IVIGILLVTTLHFASVVKTISLTVNIIFIAKASVLLGASVVFSSLVHRYAFSDWPLMIQT
LLAIGLTVLCYALLALLLGLVKKEEATRIPLIGSFLSKLIPA
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagcagacgtttctgaaaggcacttttattctgattatcgcagggctcatcaca
agatttctcggatttgtgaacagaatcgtcgtcgcacgtattatgggtgctgagggggta
ggcctatatgtcatggctgtgcccaccttgcttctcgtcattacgattacccaattcggt
ctcccagttgccatttcaaagctcgtagccgaggccgacgctttaaatgatcgctcacga
attaagcgaattctcgtcgtgtctacgacgattacactgacgctaagtatcgtctttacg
accgcgatgattttgttagctcccatgatagcgtccacccttttaaccgattcaagggcg
tattggccacttgtagccatttccccaattgtcccgatcgtggccctttcatcggtcatg
cgcggctattttcaagggttgcaaaacatgaaaccaaccgcttattcacaagtaattgaa
caagtggttcggattacatttgtcgctttattgacaagcgcctttcttccattaggggtc
gaatatgctgctgctggagcgatgatctccgtcgtcctcggtgaactagcttccttgctg
tatatgatcgtcatgttcaaacgaaaaaaaagctttcgtatccgtcagaagtttttcgct
tatttaggagaagggaagaaaacattcgtcgaccttatggccatttccgtgccgacaacc
gggagccgcttagtcggatcggtctcttattttttcgaaccaattgtcgtcgcccaaagc
cttgcgcttgccggcgtagcaacggctgtagccacacagcaatacggtcagctcgctggg
tttgtcattccattattaacgctaccaacgtttattacgtattctctttcagtatcactc
gttcctgcaattagtgaggccgctgcgaaaaaacggtatccattaatccatcatcgcctt
ggccaagcgctgcgactcgctatgctgtcaggcgggatatccgttgttgtcctctacgta
tttgccgaaccagttatggcgttaatgtacgacgcgcctgaggcggctgtttttattaaa
gtaatggcgccatttacgatctttttatacttccagggtccactccaatcgacgctacaa
gccttaaatttagccaaagctgcgatgatgaatagcttttatggggcgattgtgaaaatc
gctgcgatcttcgctcttgctactcgaccagagcttggcatcatgggagccgcgttagcg
attgtgatcgggattctcctcgtcaccacgttacattttgcttctgttgtaaaaaccatc
agtctgacggtgaatatcatctttatcgccaaggcttccgtccttctcggagcatccgtt
gtctttagcagtctcgtacatcgttatgcattttcagattggccccttatgatacaaaca
ttgctagcgatcggactgacggtgttatgttatgcgttgctcgccctacttctcggctta
gtgaaaaaagaagaagccacgcgaatccctctgatcggctcattcttaagcaagcttatt
ccagcatag

DBGET integrated database retrieval system