KEGG   Bacillus halodurans: BH1243Help
Entry
BH1243            CDS       T00039                                 

Definition
(GenBank) BH1243; unknown conserved protein
  KO
K07560  D-aminoacyl-tRNA deacylase [EC:3.1.1.96]
Organism
bha  Bacillus halodurans
Brite
KEGG Orthology (KO) [BR:bha00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bha03016]
    BH1243
Enzymes [BR:bha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.96  D-aminoacyl-tRNA deacylase
     BH1243
Transfer RNA biogenesis [BR:bha03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Trans-editing factors
    BH1243
 Prokaryotic Type
    BH1243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tyr_Deacylase
Motif
Other DBs
NCBI-ProteinID: BAB04962
UniProt: Q9KDH0
LinkDB All DBs
Position
1336759..1337199
Genome map
AA seq 146 aa AA seqDB search
MKVVLQRAKQAQVTVEGETVGAIDHGLVLLIGITHGDTEEDARYLAEKIAHLRIFEDEGG
KMNQSVKDVGGAILSISQFTLYGDCRKGRRPNFMEAAKPEHAEPLYETLNSHLEQLGLHV
ETGRFGAMMDVQLINDGPVTLLVESK
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttgtgttgcaacgagcaaaacaggcacaggtaacagtggaaggggaaactgtt
ggtgccattgaccatggccttgttctccttattggtattacccatggggatacagaggaa
gacgctcgctaccttgcggagaaaattgctcatttgcgtatttttgaagatgagggcggg
aaaatgaatcaatcggtaaaagatgtaggtggcgccatattgtccatttcccaatttacc
ctttatggcgactgtcgaaaagggagacgtccgaactttatggaggcggcaaaaccggaa
catgcagaaccgctttacgagacgcttaacagccatttagagcaattaggccttcacgtg
gagactggccggtttggcgccatgatggacgtccagttgattaacgatggacctgttacc
ttacttgtagaaagtaaatag

DBGET integrated database retrieval system