KEGG   Bacillus halodurans: BH1409Help
Entry
BH1409            CDS       T00039                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bha  Bacillus halodurans
Brite
Enzymes [BR:bha01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BH1409 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: BAB05128
UniProt: Q9KD10
LinkDB All DBs
Position
1492855..1493463
Genome map
AA seq 202 aa AA seqDB search
MAFELPKLPYPANALEPHIDEATMNIHHGKHHNTYVTKLNAALEGHSALAEKSIEALVSD
LDAVPENIRTAVRNNGGGHANHTLFWQILSPNGGGAPTGELADAINAEFGSFDQFKEKFA
DAAANRFGSGWAWLVVNDGKLEITSTPNQDTPLMEGKTPILGLDVWEHAYYLNYQNRRPD
YISAFWNVVNWDEVAKRYNEAK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgaactaccaaaactaccgtatcctgcaaatgcacttgaaccacacatcgat
gaggcaacgatgaacattcaccacgggaagcaccataacacgtatgtaacaaaattaaat
gcagctcttgaaggtcacagtgctcttgctgaaaagtcaattgaagcgcttgtcagcgac
ctcgatgctgtaccagaaaacattcgtacagcagtccgcaataatggtggtggccatgca
aaccacacgcttttttggcaaattcttagcccgaatggtggaggcgctcctactggtgag
cttgcagatgcgatcaatgctgaattcggtagctttgatcaattcaaagaaaaatttgca
gacgcagcagcaaaccgcttcggttctggctgggcgtggcttgttgtcaatgatggcaaa
ctagaaatcacaagcactccaaaccaagatacgccattaatggaagggaaaacaccaatt
cttggcttagacgtatgggagcatgcatactacttgaattaccaaaaccgtcgtcctgat
tacatttcagctttctggaacgttgtcaattgggacgaagtagcgaagcgttacaacgaa
gcaaaataa

DBGET integrated database retrieval system