KEGG   Bacillus halodurans: BH2504Help
Entry
BH2504            CDS       T00039                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bha  Bacillus halodurans
Brite
KEGG Orthology (KO) [BR:bha00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bha01001]
    BH2504
Enzymes [BR:bha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BH2504
Protein kinases [BR:bha01001]
 Serine/threonine kinases: Other
  Bacterial family
   BH2504
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr Kinase-like APH RIO1 Kdo Wzz Haspin_kinase PBP_N FTA2 PBP1_TM
Motif
Other DBs
NCBI-ProteinID: BAB06223
UniProt: Q9K9Z0
LinkDB All DBs
Position
complement(2621753..2623747)
Genome map
AA seq 664 aa AA seqDB search
MIGKRISGRYEILETIGGGGMADVYKAMDVILDRQVAVKVLQAQFSKDEQFIKRFRREAQ
AATSLAHQNVVSIYDVGEEENLYYIVMEYVEGPTLKELIQQRGPLPVDETIDIMSQMMAA
ISHAHMNQIVHRDIKPHNILIGEDGVVKVTDFGIARAMSSATITHTNSVMGSVHYLSPEQ
ARGGLVTFKSDIYSLGIVLFEMVTGQLPFSGDTAVSIALKHLQNDIPSPKEIQPSLPQSI
ENVIVKATAKDPFYRYGSVSEMDEDLSTALDPARVNERPYDQKEDDEEATKAIPIIKDEQ
LEQEDFEKTMEAPPIKKVEEPKAPAAEEKVKKPKKKRRKWLWAVLIVLFLLIGTGVTALA
LMPSWFQVDDVDVPDVRESSFEEAEAELRSLGLEVEREDVEDDAPAEEVVSQHPRPGSVV
KQGSTVRLFVSTGPEEGQMIDVTGRTIEEAQRLLNDFADVRLEERETNDVSPGIVIEQTP
EAGESVVPEETTVTLIYSATSDIVLENMQGMTENEAHGYLQENGLRTRFSYDYSSSVAEG
RVISHSPASGATVSEGDDVTIVVSRGPEPQTDQGGGQQEQPQQPQQPQTRSHLVNQPIEA
SQEVQVRIVYRDATTGGQDRVFIDETISETKTYQIPLEASADQPGSFDLYINGEFVKSSR
EYTY
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgatagggaagcgaattagtggtcgctatgaaattctagaaacaattggtggcggcggg
atggccgatgtatacaaagcaatggacgtcattttggaccgccaagtcgctgtgaaagtc
ttgcaggctcaattttcgaaagatgaacagttcattaagcggtttcgccgcgaagcccaa
gcagcaaccagcttagcccatcaaaatgtcgtcagtatttatgatgtaggggaagaagag
aacctatactacatcgtcatggagtacgtggagggccctactcttaaggagctgatccaa
cagcgagggccgttacctgttgacgaaacgattgatattatgagtcaaatgatggcggca
atctctcacgcccacatgaatcaaatcgtccaccgtgacattaaacctcataacatttta
attggtgaggatggtgtcgtaaaggtgactgactttggcattgcccgcgccatgtcatct
gcgacgattacccatacaaactcggtgatgggttccgtccattacttatcaccagaacaa
gcacgaggcggccttgttacatttaagtccgatatttactccctcggaattgtgctgttt
gaaatggtaacgggtcaactgccgttttcaggtgacacagccgtctcgattgccttaaag
catttgcaaaatgacattccgtcgccgaaagaaattcagccatctttgccgcaaagcatt
gaaaacgtgattgtgaaagcgacagcgaaagatccgttttaccggtacggatctgtctcg
gagatggacgaggatttatcaactgccctcgatcctgctagagtgaatgagcgtccttat
gatcagaaagaggatgacgaggaagcaacaaaggcgatccccattataaaagacgagcag
ttagagcaagaggatttcgaaaagacaatggaagctcctccgatcaaaaaggtcgaggaa
ccgaaggcgcctgcagcagaagagaaagtaaagaagccgaaaaagaaaaggcggaaatgg
ttgtgggcggtcttgatcgttctcttcctgctaattgggacgggtgttacagcgcttgcc
ttaatgccgagctggttccaagtagatgatgtggacgttccggatgttcgagagagttcg
tttgaagaggctgaagcagaactgagaagcctaggtttggaagtggagcgagaagatgtg
gaggacgatgctcctgcagaagaagtcgtcagtcaacatccacgaccaggctctgtcgtc
aaacaagggtcgactgttcgattattcgtgagcacgggccctgaggaagggcagatgatt
gatgtcacaggcagaacgattgaagaagctcagcgtttattaaatgattttgccgatgtc
cggttagaagagcgggaaacgaatgatgtttcaccaggcatcgtcattgagcaaacgcca
gaagctggtgagtcggttgtccctgaggaaacaaccgttaccctgatctatagtgcaacg
agcgacattgtcttggaaaatatgcaaggaatgaccgagaatgaggctcatgggtattta
caggaaaacggtcttcgcacacgtttttcctatgattattccagttctgttgcggagggg
cgagtcatctctcattcgccagcgagcggggcgacggtaagcgagggggatgacgttacc
attgtagtttcacggggacctgaaccacaaacggatcagggaggcggtcagcaagaacag
ccgcagcaaccgcagcagccgcaaacccgctctcatctggtaaaccaaccgattgaggca
tcacaagaagtgcaagttcgtatcgtctaccgtgacgcaacgacaggtggacaggatcgg
gtgtttatagatgaaacaatcagtgaaacgaaaacatatcaaattccattagaagcgagt
gcggatcaacctgggtcgtttgacctttacattaacggtgaattcgtcaaatcatcgaga
gagtatacctattga

DBGET integrated database retrieval system