KEGG   Bacillus halodurans: BH3091Help
Entry
BH3091            CDS       T00039                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bha  Bacillus halodurans
Pathway
bha00020  Citrate cycle (TCA cycle)
bha00190  Oxidative phosphorylation
bha00650  Butanoate metabolism
bha01100  Metabolic pathways
bha01110  Biosynthesis of secondary metabolites
bha01120  Microbial metabolism in diverse environments
bha01130  Biosynthesis of antibiotics
bha01200  Carbon metabolism
Module
bha_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bha_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BH3091 (sdhB)
   00650 Butanoate metabolism
    BH3091 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BH3091 (sdhB)
Enzymes [BR:bha01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BH3091 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     BH3091 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4_16 Fer4_2 Fer4_17 Fer4 Fer4_18 Fer4_13 Fer4_20 Fer4_4 Fer4_21 Fer4_3 Fer4_15
Motif
Other DBs
NCBI-ProteinID: BAB06810
UniProt: Q9K8B5
LinkDB All DBs
Position
complement(3204762..3205517)
Genome map
AA seq 251 aa AA seqDB search
MSENVVRFIITRQDDPDSSPYEEEFQVPYRQNMNVISALMEIRRNPVNSKGETSTPVAWE
MNCLEEVCGACSMVINGKPRQSCTALVDQLEQPIRLEPMKTFPVVRDLVIDRSRMFDSLK
KVKAWIPIDGTYDLGPGPRMAESKRQWAYELSKCMTCGVCLEACPNVNSKSEFIGPAPLS
QVRLFNAHPTGEMNKEERLQAIMGDGGLANCGNSQNCVQSCPKGIPLTTSIAALNRSATL
QSFKNFFGSTN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaaacgtcgtacgtttcattattactcgtcaagatgacccagatagcagtcct
tatgaagaagagtttcaggtcccgtaccgtcaaaatatgaatgtcatttcggctttaatg
gagattcgccgaaatccggtaaacagcaagggtgaaacgagcacaccagttgcttgggaa
atgaactgcttggaagaggtttgcggagcgtgttccatggtcattaacggcaaaccgcga
caatcatgtacggccctagtggatcaactggagcagcccattcgcctagagccgatgaaa
acattccctgtagtccgtgacctagtcattgaccgcagccggatgtttgactcattgaaa
aaagtaaaggcatggattccgatcgatggaacttacgatttaggtcctggcccacgaatg
gcagagtcgaagcgtcaatgggcgtatgagctttcaaaatgtatgacgtgtggagtttgc
ttagaagcatgtccaaacgttaacagcaagtcagaattcattggcccagcgccgctatca
caagttcgtctttttaacgcccacccaacaggcgagatgaacaaagaggaacgactccaa
gcgatcatgggagacggtggacttgcgaactgtggaaactcacaaaactgcgttcaatca
tgtccgaaaggaattccgcttacaacgtcaattgcggcattaaaccgttcggctacgttg
cagtcgttcaaaaacttctttggcagcacaaactaa

DBGET integrated database retrieval system