KEGG   Bacillus halodurans: BH3092Help
Entry
BH3092            CDS       T00039                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
bha  Bacillus halodurans
Pathway
bha00020  Citrate cycle (TCA cycle)
bha00190  Oxidative phosphorylation
bha00650  Butanoate metabolism
bha01100  Metabolic pathways
bha01110  Biosynthesis of secondary metabolites
bha01120  Microbial metabolism in diverse environments
bha01130  Biosynthesis of antibiotics
bha01200  Carbon metabolism
Module
bha_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bha_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BH3092 (sdhA)
   00650 Butanoate metabolism
    BH3092 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BH3092 (sdhA)
Enzymes [BR:bha01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BH3092 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     BH3092 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like FAD_binding_3 AlaDh_PNT_C FAD_oxidored NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: BAB06811
UniProt: Q9K8B4
LinkDB All DBs
Position
complement(3205514..3207283)
Genome map
AA seq 589 aa AA seqDB search
MSKGKVIVVGGGLAGLMATIKVAEAGVPVELFSLVPVKRSHSVCAQGGINGAVNTKGEGD
SPWEHFDDTVYGGDFLANQPPVKAMCDAAPGIIHLMDRMGVMFNRTAEGLLDFRRFGGTQ
HHRTAFAGATTGQQLLYALDEQVRRHETSGLVTKYEGWEFISAIIDDEGICRGITAQNLK
TSEFQSFSADAVIMATGGPGIIFGKSTNSVINTGYAAAKLYEQGVYYANGEFIQIHPTAI
PGDDKLRLMSESARGEGGRVWTYKDGKPWYFLEEKYPAYGNLVPRDIATREIFHVCVDLK
LGINGENMVYLDLSHKDPKELDIKLGGIIEIYEKFMGDDPRKVPMKIFPAVHYSMGGMWI
DYDQMTNIPGLFAAGECDYSQHGANRLGANSLLSAIFGGMVAGPKAVEYMNGLEKSAESM
PSSLFEGELKKEQEKFDDILKMDGKENAYVLHKELGEWMTDNVTVVRYNDKLLKTDEKIQ
ELMERYKNIDINDTAKWSNQGASFTRQLDGMLKLARVITLGAYNRNESRGAHYKPDFPER
NDEEFLKTTKAKFNPETLAPEFEYEEVDVSLIEPRKRDYSQKKQGAVKS
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaggaaaagtcatcgttgtcggtggaggccttgcaggtcttatggcaactatt
aaggtagcagaggcaggcgtcccggtggagcttttttctctcgttcctgttaaacggtct
cactctgtctgtgctcaaggcgggataaatggtgctgtcaacacgaaaggggaaggggac
tctccgtgggagcactttgacgatactgtatatggtggagatttcttagcgaaccaacca
ccagttaaagcaatgtgtgatgcggcgcctggaatcattcacttaatggaccgtatgggc
gtcatgtttaaccgaacagcggaaggtttgcttgatttccgtcgttttggtggaactcaa
catcaccgtaccgcgtttgctggagcaacaactggtcagcagttgttatatgcattagat
gagcaagtacgtcgccatgaaacatctggtctcgtaacaaaatatgagggctgggagttt
atttcagctattatcgatgatgaaggaatctgtcgaggcatcacagcgcaaaacttgaaa
acatctgagttccagagtttttcagctgacgctgtgattatggcaacaggtggtcctgga
atcatcttcggaaaatctacgaactctgttatcaatacggggtatgcagcagctaagctt
tatgagcaaggtgtatattatgcaaacggggaatttatccaaattcacccgacagcgatt
cctggggatgataaactccgcctcatgagtgaatctgctcgcggggaaggtggtcgtgtg
tggacatacaaggacgggaaaccgtggtatttcctcgaagaaaaatacccggcatacgga
aatcttgtacctcgtgatatcgccacacgggaaatcttccacgtttgtgtcgacttaaag
ctcggaattaatggtgaaaacatggtatacctggatctttctcataaagacccgaaagag
ctcgatattaagcttggtggaatcattgaaatttatgagaagttcatgggagatgaccca
cgtaaagtacctatgaaaattttcccagcggttcattactcaatgggcggcatgtggatc
gattacgatcaaatgacaaacattccaggcttgtttgctgcaggagagtgcgactattcg
cagcatggggccaaccgtctcggagcaaactctctcttatcagcgatttttggtggaatg
gtggctggacctaaagcagttgagtatatgaacggtcttgaaaagtctgcagaatccatg
ccttcgtctttatttgaaggtgaactgaagaaagaacaagaaaaattcgatgacatcttg
aaaatggatggaaaagaaaatgcgtacgttctccataaagagctcggtgaatggatgacg
gataacgtgacggtcgttcgctataacgataagctactcaaaacggatgagaagattcag
gagctcatggaacgctataaaaacatcgacatcaatgatacggcgaaatggagcaaccaa
ggggcatcgttcacccgtcagcttgatggtatgttaaagctcgctcgcgtgatcacgtta
ggggcgtacaaccgtaatgaaagccgtggagcgcattacaagccagacttcccagagcgt
aatgatgaggaattcctcaagacgacaaaagcgaaattcaacccagaaacgttggcgcca
gagtttgaatacgaggaagtggatgtatccttaatcgaaccgcgtaagcgtgactactct
caaaagaagcaaggagctgttaaatcatga

DBGET integrated database retrieval system